1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. CSF & Receptors Stem Cell CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. IL-3R alpha/CD123
  5. IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His)

IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His)

Cat. No.: HY-P70461
SDS COA Handling Instructions

IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation. IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His) is 285 a.a., with molecular weight of 50-65 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation. IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His) is 285 a.a., with molecular weight of 50-65 kDa.

Background

The IL-3R alpha/CD123 Protein is a crucial member of the type I cytokine receptor family, specifically categorized within the Type 5 subfamily, emphasizing its pivotal role in mediating cellular responses to various cytokines. As part of this receptor family, IL-3R alpha/CD123 likely shares conserved structural and functional features with related receptors, underscoring its involvement in transducing signals from specific type I cytokines. The classification within the type I cytokine receptor family underscores its specific designation within the broader context of cell signaling, providing insights into its unique contributions to hematopoiesis and immune regulation. The study of IL-3R alpha/CD123 contributes to our understanding of its role in physiological processes, offering potential applications in therapeutic interventions for conditions related to hematopoietic disorders and immune dysregulation. Further exploration of IL-3R alpha/CD123's role holds promise for enhancing our knowledge of its contributions to both normal cellular function and pathological conditions.

Biological Activity

Measured by its binding ability in a functional ELISA. When Recombinant Cynomolgus Monkey IL-3R alpha protein is represent at 1 µg/mL (100 µg/mL) can bind Recombinant Human IL-3 Protein. The ED50 for this effect is 14.83 ng/mL.

Species

Cynomolgus

Source

HEK293

Tag

C-6*His

Accession

G8F3K3 (R18-R302)

Gene ID

102138639

Molecular Construction
N-term
IL-3Rα (R18-R302)
Accession # G8F3K3
6*His
C-term
Synonyms
Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA; CD123
AA Sequence

RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSR

Molecular Weight

50-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His)
Cat. No.:
HY-P70461
Quantity:
MCE Japan Authorized Agent: