1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens Biotinylated Proteins
  3. CSF & Receptors Stem Cell CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. IL-3R alpha/CD123
  5. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi)

IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi)

Cat. No.: HY-P72349
Handling Instructions Technical Support

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

Background

IL-3R alpha/CD123 Protein serves as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, exerting control over the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, it rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins, including JAK2 and PI3K. These activated pathways play a crucial role in signaling cell proliferation and differentiation. JAK2 activation further initiates a STAT5-mediated transcriptional program, contributing to the regulation of cellular functions. The receptor interacts with its ligand, IL3, and forms a heterodimer consisting of an alpha and a beta subunit. Notably, the beta subunit is shared among the receptors for IL3, IL5, and GM-CSF.

Species

Human

Source

HEK293

Tag

C-Avi;C-hFc

Accession

P26951-1 (T19-R305)

Gene ID
Molecular Construction
N-term
IL-3Rα (T19-R305)
Accession # P26951-1
hFc-Avi
C-term
Synonyms
Interleukin-3 receptor subunit alpha; IL-3 receptor subunit alpha; IL-3R subunitalpha; IL-3R-alpha; IL-3RA; CD123
AA Sequence

TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

Molecular Weight

80-100 kDa

Purity

Greater than 90% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi)
Cat. No.:
HY-P72349
Quantity:
MCE Japan Authorized Agent: