1. Recombinant Proteins
  2. Cytokines and Growth Factors CD Antigens
  3. CSF & Receptors Stem Cell CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  4. IL-3R alpha/CD123
  5. IL-3R alpha/CD123 Protein, Mouse (HEK293, His)

IL-3R alpha/CD123 Protein, Mouse (HEK293, His)

Cat. No.: HY-P72542
Handling Instructions Technical Support

IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.

Background

The IL-3R alpha/CD123 protein functions as a cell surface receptor for IL3 and is expressed on hematopoietic progenitor cells, monocytes, and B-lymphocytes, governing the production and differentiation of hematopoietic progenitor cells into lineage-restricted cells. Upon ligand stimulation, IL-3R alpha rapidly undergoes heterodimerization with IL3RB, leading to the phosphorylation and activation of effector proteins such as JAK2 and PI3K. These activated proteins play a crucial role in signaling cell proliferation and differentiation. The activation of JAK2, in particular, initiates a STAT5-mediated transcriptional program. IL-3R alpha interacts with IL3 and forms a heterodimer with an alpha and a beta subunit, with the beta subunit being common to the IL3, IL5, and GM-CSF receptors. These interactions highlight the intricate molecular mechanisms through which IL-3R alpha regulates signaling pathways, contributing to the modulation of hematopoietic cell development and function.

Species

Mouse

Source

HEK293

Tag

C-8*His

Accession

P26952-1 (S17-K331)

Gene ID
Molecular Construction
N-term
IL-3Rα (S17-K331)
Accession # P26952-1
hFc
C-term
Synonyms
Interleukin-3 receptor subunit alpha; IL-3R-alpha; IL-3RA; CD123; Sut-1
AA Sequence

SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK

Molecular Weight

50-65 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-3R alpha/CD123 Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72542
Quantity:
MCE Japan Authorized Agent: