IL-4 Protein, Bovine

IL-4 Protein, a key participant in B-cell activation and various cell types, acts as a costimulator of DNA synthesis. It induces class II MHC molecules on B-cells, enhances IgE and IgG1 secretion and expression, and regulates CD23 on lymphocytes and monocytes. IL-4 positively regulates IL31RA in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4. IL-4 Protein, Bovine is the recombinant bovine-derived IL-4 protein, expressed by E. coli , with tag free.

IL-4 protein actively participates in multiple B-cell activation processes and influences various cell types as a critical regulator. Functioning as a costimulator, IL-4 stimulates DNA synthesis and induces the expression of class II MHC molecules on resting B-cells. Furthermore, it plays a pivotal role in enhancing both the secretion and cell surface expression of IgE and IgG1, contributing to immune responses. IL-4 also regulates the expression of the low-affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Beyond its effects on B-cells, IL-4 positively regulates IL31RA expression in macrophages, further diversifying its immunomodulatory functions. Additionally, IL-4 stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4, underscoring its intricate involvement in cellular processes across different immune cell types.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 0.1303 ng/mL ,corresponding to a specific activity is 7.675×10⁶ U/mg

Bovine

E. coli

Tag Free

P30367 (H25-C135)

280824  [NCBI]

HKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAPKNTTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDLLERLKTIMKEKYSKC

Approximately 12.7 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.