IL-4 Protein, Canine

The IL-4 protein actively participates in the B cell activation process, acting as a costimulator for DNA synthesis. It induces the expression of class II MHC molecules on resting B cells, enhances IgE and IgG1 secretion and cell surface expression, and modulates CD23 expression on lymphocytes and monocytes. IL-4 Protein, Canine is the recombinant canine-derived IL-4 protein, expressed by E. coli , with N-Met labeled tag. The total length of IL-4 Protein, Canine is 108 a.a., with molecular weight of 12-14 kDa.

IL-4 protein actively participates in multiple B-cell activation processes and various cell types, serving as a costimulator of DNA synthesis. It induces the expression of class II MHC molecules on resting B-cells, enhances the secretion and cell surface expression of IgE and IgG1, and regulates the expression of the low affinity Fc receptor for IgE (CD23) on lymphocytes and monocytes. Furthermore, IL-4 positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Measured in a cell proliferation assay using TF-1 human erythroleukemic cells and the ED₅₀ is typically 5-30 ng/mL.

Canine

E. coli

Tag Free

O77762 (H25-H132)

403785  [NCBI]

HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH

12-14 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.