IL-4 Protein, Cynomolgus (P.pastoris, His)

IL-4 protein has an important effect on B cell activation, acting as a costimulator for DNA synthesis and promoting the expression of class II MHC molecules on resting B cells. It enhances IgE and IgG1 secretion and cell surface expression while also regulating CD23 expression on lymphocytes and monocytes. IL-4 Protein, Cynomolgus (P.pastoris, His) is the recombinant cynomolgus-derived IL-4 protein, expressed by P. pastoris , with N-His labeled tag. The total length of IL-4 Protein, Cynomolgus (P.pastoris, His) is 129 a.a., with molecular weight of ~16.9 kDa.

IL-4 protein plays a pivotal role in various B-cell activation processes and other cell types, acting as a costimulator for DNA synthesis. Additionally, it promotes the expression of class II MHC molecules on resting B-cells and enhances the secretion and cell surface expression of both IgE and IgG1. IL-4 also regulates the expression of CD23, the low affinity Fc receptor for IgE, on lymphocytes and monocytes. Furthermore, it positively regulates IL31RA expression in macrophages and stimulates autophagy in dendritic cells by interfering with mTORC1 signaling and inducing RUFY4.

Cynomolgus

P. pastoris

N-His

P79339 (H25-S153)

107130068  [NCBI]

HKCDITLQEIIKTLNSLTEQKTLCTKLTITDILAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS

Approximately 16.9 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.