1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors Neurotrophic Factors
  4. IL-6
  5. IL-6 Protein, Equine

IL-6 protein is a crucial cytokine in immunity, tissue regeneration and metabolism. It binds to IL6R and forms a complex that binds to IL6ST/gp130, triggering intracellular IL6 signaling. Membrane-bound IL6:IL6R complexes induce "cluster signaling" that activates IL6ST receptors on neighboring cells. IL-6 Protein, Equine is the recombinant equine-derived IL-6 protein, expressed by E. coli , with tag free.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-6 protein is a crucial cytokine in immunity, tissue regeneration and metabolism. It binds to IL6R and forms a complex that binds to IL6ST/gp130, triggering intracellular IL6 signaling. Membrane-bound IL6:IL6R complexes induce "cluster signaling" that activates IL6ST receptors on neighboring cells. IL-6 Protein, Equine is the recombinant equine-derived IL-6 protein, expressed by E. coli , with tag free.

Background

IL-6, a multifunctional cytokine, exerts diverse biological effects in immunity, tissue regeneration, and metabolism. Upon binding to its receptor, IL6R, the complex associates with the signaling subunit IL6ST/gp130, initiating the intracellular IL6-signaling pathway. This interaction can elicit 'classic signaling' when IL6 binds to membrane-bound IL6R, or 'trans-signaling' when IL6 and soluble IL6R engage IL6ST. Additionally, 'cluster signaling' occurs when IL6:IL6R complexes on transmitter cells activate IL6ST receptors on neighboring receiver cells. IL-6 is a crucial inducer of the acute phase response, rapidly produced during infection and tissue injury for host defense. However, excessive IL-6 synthesis is implicated in various disease pathologies. In the innate immune response, myeloid cells, including macrophages and dendritic cells, synthesize IL-6 upon recognizing pathogens through toll-like receptors (TLRs) at infection sites or tissue injuries. In the adaptive immune response, IL-6 is essential for B cell differentiation into immunoglobulin-secreting cells, T follicular helper (Tfh) cell development, and driving naive CD4(+) T cells toward the Th17 lineage. Furthermore, IL-6 plays a significant role in myeloma cell proliferation and the survival of plasmablast cells.

Biological Activity

Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 0.6786 ng/mL, corresponding to a specific activity is 1.474×106 units/mg.

  • Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is 0.6786 ng/mL,corresponding to a specific activity is 1.474×106 units/mg.
Species

Equine

Source

E. coli

Tag

Tag Free

Accession

Q95181 (F26-M208)

Gene ID

100034196  [NCBI]

Molecular Construction
N-term
IL-6 (F26-M208)
Accession # Q95181
C-term
Synonyms
IL6; Interleukin-6; BSF2; HSF; IFNB2; Interleukin 6
AA Sequence

FPTPLPLGEDETTSNGPLLTTADKTKQHIKYILGKISALKNEMCNNFSKCENSKEVLAENNLNLPKMAEKDGCFQSGFNQETCLMKITTGLSEFQIYLEYLQNEFKGEKENIKTMQISTKVLVQILMQKMKNPEVTTPDPTAKSSLLAKLHSQNEWLKNTTTHLILRSLEDFLQFSLRAVRIM

Molecular Weight

Approximately 21 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 6.5, 8% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-6 Protein, Equine
Cat. No.:
HY-P79101
Quantity:
MCE Japan Authorized Agent: