IL-7 Protein, Human (HEK293, His)

IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (HEK293, His) is the recombinant human-derived IL-7 protein, expressed by HEK293 , with C-6*His labeled tag.

The IL-7 protein serves as a crucial hematopoietic cytokine, playing an indispensable role in the development, expansion, and survival of both naive and memory T-cells as well as B-cells, thereby regulating the population of mature lymphocytes and maintaining lymphoid homeostasis. Its biological effects are executed through a receptor comprised of the IL7RA subunit and the cytokine receptor common subunit gamma/CSF2RG. Upon binding to the receptor, IL-7 activates various kinases, including JAK1 or JAK3, depending on the cell type. This activation leads to the propagation of signals through multiple downstream pathways, such as the PI3K/Akt/mTOR or the JAK-STAT5 pathways. IL-7's interaction with IL7R and CSF2RG highlights its pivotal role in orchestrating diverse signaling cascades crucial for immune cell development and function.

1.The cell proliferation assay using PHA-activated human peripheral blood lymphocytes has an ED₅₀ value of 50-300 pg/mL.
2. Mouse IL-7RA-Fc can bind Human IL-7-His with an affinity constant of 29.0 nM as determined in BLI assay.
3. Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED₅₀ this effect is 1.822 ng/mL, corresponding to a specific activity of 5.489×10⁵ units/mg.

• 
  1.The cell proliferation assay using PHA-activated human peripheral blood lymphocytes has an ED₅₀ value of 50-300 pg/mL. Mouse IL-7RA-Fc can bind Human IL-7-His with an affinity constant of 29.0 nM. 2. Measured in a cell proliferation assay using HT-2 mouse T lymphocyte cells. The ED₅₀ this effect is 1.822 ng/mL, corresponding to a specific activity is 5.489×10⁵ units/mg.

Human

HEK293

C-6*His

P13232-1 (D26-H177)

3574  [NCBI]

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

19-30 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US;may vary elsewhere.