IL-9 Protein, Human (CHO)

IL-9 Protein, Human (CHO) is a CHO cell derived immunoregulatory cytokine produced by IL-2 activated Th2 lymphocytes.

Interleukin 9 (IL-9) is cytokine produced by a subgroup of helper T cells, known as Th2 cells. IL-9 signals through its receptor IL-9R to induce cell proliferation and survival. Genetically, IL-9 has been identified as a gene associated with asthma.Human interleukin-9 (IL-9) was originally identified and cloned based on its stimulatory effect on proliferation of human myeloid cell line, M07e. IL-9 synergized with Steel factor, the ligand for the c-kit product, to stimulate M07e cell proliferation^[1]

The ED₅₀ is <1 ng/mL as measured by MO7e cells, corresponding to a specific activity of >1 × 10⁶ units/mg.

Human

CHO

Tag Free

P15248 (Q19-I144)

3578  [NCBI]

QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

25-40 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Miyazawa K, et al. Recombinant human interleukin-9 induces protein tyrosine phosphorylation and synergizes with steel factor to stimulate proliferation of the human factor-dependent cell line, M07e. Blood. 1992 Oct 1;80(7):1685-92.  [Content Brief]