1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-9
  5. IL-9 Protein, Mouse (CHO)

IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

Background

Interleukin 9 (IL-9) is cytokine produced by a subgroup of helper T cells, known as Th2 cells. IL-9 signals through its receptor IL-9R to induce cell proliferation and survival. Genetically, IL-9 has been identified as a gene associated with asthma.Human interleukin-9 (IL-9) was originally identified and cloned based on its stimulatory effect on proliferation of human myeloid cell line, M07e. IL-9 synergized with Steel factor, the ligand for the c-kit product, to stimulate M07e cell proliferation[1]

Biological Activity

Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 3.339 ng/mL, corresponding to a specific activity is 3.0×105 units/mg.

  • Measured in a cell proliferation assay using MO7e human megakaryocytic leukemic cells. The ED50 for this effect is 3.339 ng/mL, corresponding to a specific activity is 3.0×105 units/mg.
Species

Mouse

Source

CHO

Tag

C-6*His

Accession

P15247 (Q19-P144)

Gene ID
Molecular Construction
N-term
IL-9 (Q19-P144)
Accession # P15247
6*His
C-term
Synonyms
rMuIL-9; Cytokine P40; T-cell Growth Factor P40
AA Sequence

QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Molecular Weight

28-42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized after extensive dialysis against PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

IL-9 Protein, Mouse (CHO) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-9 Protein, Mouse (CHO)
Cat. No.:
HY-P7083
Quantity:
MCE Japan Authorized Agent: