1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Interleukin & Receptors
  4. IL-9
  5. IL-9 Protein, Mouse (sf9, His)

IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (sf9, His) is the recombinant mouse-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IL-9 is secreted by T helper 2 lymphocytes, mast cells, and NKT cells and plays an important role in antiparasitic immune responses, affecting intestinal permeability, adaptive immunity, and T cell subset differentiation.It promotes TH17 cell and mast cell proliferation through IL9R and IL2RG receptor activation, triggering JAK1 and JAK3 kinases and subsequent STAT-mediated transcription.IL-9 Protein, Mouse (sf9, His) is the recombinant mouse-derived IL-9 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Background

IL-9, a multifunctional cytokine primarily secreted by T-helper 2 lymphocytes and also by mast cells or NKT cells, assumes crucial roles in the immune response against parasites. Beyond its anti-parasitic function, IL-9 influences intestinal epithelial permeability and adaptive immunity. It plays a pivotal role in inducing the differentiation of specific T-cell subsets, such as IL-17-producing helper T-cells (TH17), and promotes the proliferation and differentiation of mast cells. Mechanistically, IL-9 exerts its diverse biological effects through a receptor comprised of the IL9R subunit and the signal transducing subunit IL2RG. Stimulation of this receptor leads to rapid activation of JAK1 and JAK3 kinase activities, initiating STAT1, STAT3, and STAT5-mediated transcriptional programs. The induction of differentiation genes appears to be mediated by STAT1 alone, while the protection of cells from apoptosis depends on the concerted actions of STAT3 and STAT5. IL-9 interacts directly with IL9R and IL2RG, orchestrating a sophisticated network of interactions to modulate immune responses and cellular processes.

Biological Activity

Measured in a cell proliferation assay using MC/9 mouse mast cells and the ED50 is typically 0.2-2 ng/mL.

Species

Mouse

Source

Sf9 insect cells

Tag

C-His

Accession

P15247 (Q19-P144)

Gene ID
Molecular Construction
N-term
IL-9 (Q19-P144)
Accession # P15247
His
C-term
Synonyms
Interleukin-9; IL-9; Cytokine P40; IL9
AA Sequence

MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Molecular Weight

Approximately 15.6 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 50 mM Tris, 150 mM NaCl, pH 8.0, 10% Glycerol. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

IL-9 Protein, Mouse (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IL-9 Protein, Mouse (sf9, His)
Cat. No.:
HY-P73229
Quantity:
MCE Japan Authorized Agent: