IL1RAPL1 Protein, Human (HEK293, His)

IL1RAPL1 protein is a multifaceted regulator that may inhibit N-type calcium channels, affecting secretion and presynaptic differentiation. It may activate MAP kinase JNK, suggesting involvement in intracellular signaling. IL1RAPL1 Protein, Human (HEK293, His) is the recombinant human-derived IL1RAPL1 protein, expressed by HEK293 , with C-6*His labeled tag.

IL1RAPL1 Protein emerges as a multifaceted regulator, potentially influencing secretion and presynaptic differentiation by inhibiting the activity of the N-type voltage-gated calcium channel. Additionally, it may activate the MAP kinase JNK, indicating its potential involvement in intracellular signaling pathways. IL1RAPL1 is implicated in neurite outgrowth, emphasizing its role in neuronal development. Remarkably, during dendritic spine formation, IL1RAPL1 demonstrates bidirectional capabilities, inducing both pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD. The diverse functional roles proposed for IL1RAPL1 underscore its significance in orchestrating complex cellular processes associated with synaptic function, neuronal development, and intracellular signaling pathways, warranting further exploration into its precise molecular mechanisms and broader implications in neuronal biology.

Human

HEK293

C-6*His

Q9NZN1-1 (L19-T357)

11141  [NCBI]

LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

50-70 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.