2. Recombinant Proteins
  3. Immune Checkpoint Proteins CD Antigens
  4. Inhibitory Checkpoint Molecules Stimulatory Immune Checkpoint Molecules T Cell CD Proteins B Cell CD Proteins NK Cell CD Proteins Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Endothelial cell CD Proteins
  5. B7-2/CD86
  6. B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc)

B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc)

Cat. No.: HY-P7835
Handling Instructions

B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc) is the recombinant Rhesus Macaque, cynomolgus-derived B7-2/CD86 protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc) Featured Recommendations:

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

B7-2/CD86 protein negatively regulates T-cell activation by disrupting CD86 cluster formation, modulating the T-cell response, and influencing immune activation. B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc) is the recombinant Rhesus Macaque, cynomolgus-derived B7-2/CD86 protein, expressed by HEK293 , with C-hFc labeled tag.
Background

B7-2/CD86 protein functions as a negative regulator of T-cell activation by disrupting the formation of CD86 clusters. Through this interference, it modulates the T-cell response and plays a role in regulating immune activation.
Species

Rhesus Macaque; Cynomolgus
Source

HEK293
Tag

C-hFc
Accession

A0A2K5TTJ8/XP_005548057.1 (A18-H239)
Gene ID

/
Molecular Construction
N-term
B7-2 (A18-H239)
Accession # A0A2K5TTJ8/XP_005548057.1
hFc
C-term
Synonyms
Activation B7-2 antigen; B70; BU63; CD86; CD28LG2
AA Sequence

APLKIQAYFNETADLPCQFANSQNRSLSELVVFWQNQENLVLNEVYLGKEKFDSVHSKYMGRTSFDPESWTLRLHNLQIKDKGLYQCIIHHKRPTGMIRIHQMNSELSVLANFSQPEIVPISNITENMYINLTCSSIHGYPEPEKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCVLETDKTQLLSSPFSIELEDPQPPPDH

Molecular Weight

90-120 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
B7-2/CD86 Protein, Cynomolgus/Rhesus Macaque (HEK293, hFc)
Cat. No.:
HY-P7835
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.