ILT6 Protein, Human (HEK293, His)

LILRA3/CD85e/ILT6 functions as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, albeit with lower affinities than LILRB1 or LILRB2. It engages with monocyte surfaces, effectively suppressing LPS-induced TNF-alpha production by monocytes. ILT6 Protein, Human (HEK293, His) is the recombinant human-derived ILT6 protein, expressed by HEK293 , with C-6*His labeled tag.

LILRA3/CD85e/ILT6 acts as a soluble receptor for class I MHC antigens, binding both classical and non-classical HLA class I molecules, although with reduced affinities compared to LILRB1 or LILRB2. This protein exhibits a high-affinity interaction with the surface of monocytes, resulting in the suppression of LPS-induced TNF-alpha production by monocytes.

Human

HEK293

C-6*His

Q8N6C8-1/AAH28208.1 (T19-E439)

11026  [NCBI]

THVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Approximately 70.0 kDa

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.