2. Recombinant Proteins
  3. Enzymes & Regulators
  4. IMPA1 Protein, Human (His)

IMPA1 Protein, Human (His)

Cat. No.: HY-P70335
Handling Instructions

IMPA1 protein provides essential inositol for the synthesis of phosphatidylinositol and polyphosphate inositol. IMPA1 Protein, Human (His) is the recombinant human-derived IMPA1 protein, expressed by E. coli , with N-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

IMPA1 protein provides essential inositol for the synthesis of phosphatidylinositol and polyphosphate inositol. IMPA1 Protein, Human (His) is the recombinant human-derived IMPA1 protein, expressed by E. coli , with N-6*His labeled tag.
Background

The IMPA1 protein plays a crucial role in providing inositol essential for the synthesis of phosphatidylinositol and polyphosphoinositides. Additionally, it has been implicated as the pharmacological target for lithium action in the brain. Demonstrating broad substrate specificity, IMPA1 can utilize various substrates, including myo-inositol monophosphates, myo-inositol 1,3-diphosphate, myo-inositol 1,4-diphosphate, scyllo-inositol-phosphate, D-galactose 1-phosphate, glucose-1-phosphate, glucose-6-phosphate, fructose-1-phosphate, beta-glycerophosphate, and 2'-AMP.
Species

Human
Source

E. coli
Tag

N-6*His
Accession

P29218-1 (M1-D277)
Gene ID
Molecular Construction
N-term
6*His
IMPA1 (M1-D277)
Accession # P29218-1
C-term
Synonyms
rHuInositol monophosphatase 1/IMPA1, His; Inositol Monophosphatase 1; IMP 1; IMPase 1; Inositol-1(or 4)-Monophosphatase 1; Lithium-Sensitive Myo-Inositol Monophosphatase A1; IMPA1; IMPA
AA Sequence

MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED

Molecular Weight

Approximately 30.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Documentation
Handling Instructions (2659 KB)

IMPA1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
IMPA1 Protein, Human (His)
Cat. No.:
HY-P70335
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.