INSL6 Protein, Human (HEK293, His)

The INSL6 protein plays a crucial role in sperm development and fertilization, highlighting its importance in male reproductive biology. Its potential function in promoting sperm development and successful fertilization emphasizes its importance in reproductive physiology. INSL6 Protein, Human (HEK293, His) is the recombinant human-derived INSL6 protein, expressed by HEK293 , with C-His labeled tag. The total length of INSL6 Protein, Human (HEK293, His) is 178 a.a., with molecular weight of ~22.1 KDa.

The INSL6 protein appears to play a crucial role in sperm development and fertilization, implying its involvement in key processes essential for reproductive success. The recognition of its potential function in these intricate stages of male reproductive biology underscores its significance in facilitating the development and maturation of sperm, as well as contributing to the successful fertilization of ova. The precise mechanisms by which INSL6 operates in these processes remain an area of interest, reflecting its potential as a key player in reproductive physiology.

Human

HEK293

C-6*His

Q9Y581/NP_009110.2 (R21-F198)

11172  [NCBI]

RELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDF

Approximately 28-40 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.