Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His)

Insulin-1 is an important regulator of glucose and can effectively lower blood sugar by increasing cellular permeability to simple sugars, amino acids, and fatty acids.Its effects include accelerating glycolysis, promoting pentose phosphate cycle, and promoting hepatic glycogen synthesis.Insulin-1/Ins1 Protein, Mouse (P.pastoris, Myc, His) is the recombinant mouse-derived Insulin-1/Ins1 protein, expressed by P.pastoris , with C-Myc, N-6*His labeled tag.

Insulin-1, a key player in glucose regulation, effectively lowers blood glucose levels by enhancing cellular permeability to monosaccharides, amino acids, and fatty acids. Its multifaceted actions include the acceleration of glycolysis, promotion of the pentose phosphate cycle, and facilitation of glycogen synthesis in the liver. Structurally, Insulin-1 exists as a heterodimer comprising a B chain and an A chain, intricately linked by two disulfide bonds. These structural features underscore its crucial role in orchestrating metabolic processes essential for maintaining glucose homeostasis.

Mouse

P. pastoris

C-Myc;N-6*His

P01325 (F25-N108)

16333  [NCBI]

FVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVEDPQVEQLELGGSPGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN

29 kDa.The reducing (R) protein migrat es as 62 kDa in SDS-PAGE may be due to relative charge.

Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HC1, 0.5 M NaCl, 6% Trehalose, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.