1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Insulin
  5. Insulin Protein, Bovine

Insulin Protein regulates glucose metabolism in the body. It binds to insulin receptors, activating signaling pathways that facilitate glucose uptake and storage. Insulin Protein also regulates lipid metabolism and protein synthesis. Understanding its functions is crucial for developing treatments for diabetes and metabolic disorders. Insulin Protein, Bovine is a recombinant protein dimer complex containing bovine-derived Insulin protein, expressed by P. pastoris, with tag free. Insulin Protein, Bovine, has molecular weight of ~6 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
5 mg In-stock
10 mg In-stock
50 mg In-stock
100 mg In-stock
> 100 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products

Publications Citing Use of MCE Insulin Protein, Bovine

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Insulin Protein regulates glucose metabolism in the body. It binds to insulin receptors, activating signaling pathways that facilitate glucose uptake and storage. Insulin Protein also regulates lipid metabolism and protein synthesis. Understanding its functions is crucial for developing treatments for diabetes and metabolic disorders. Insulin Protein, Bovine is a recombinant protein dimer complex containing bovine-derived Insulin protein, expressed by P. pastoris, with tag free. Insulin Protein, Bovine, has molecular weight of ~6 kDa.

Background

Insulin, a pivotal hormone in glucose homeostasis, plays a crucial role in reducing blood glucose concentration. Its actions extend beyond glycemic control, as it enhances cell permeability to monosaccharides, amino acids, and fatty acids. Furthermore, insulin facilitates metabolic processes such as glycolysis, the pentose phosphate cycle, and glycogen synthesis in the liver, contributing to overall energy regulation. Structurally, insulin is composed of a heterodimeric arrangement, consisting of a B chain and an A chain connected by two disulfide bonds. The multifaceted functions of insulin underscore its significance in orchestrating metabolic responses and maintaining physiological balance.

Biological Activity

Measure by its ability by a dose-response proliferation assay using human MCF7 epithelial cells. The ED50 for this effect is <1.0 μg/mL. The specific activity of this protein is > 1.0 × 103 IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Species

Bovine

Source

P. pastoris

Tag

Tag Free

Accession

P01317 (F25-A54&G85-N105)

Gene ID

/

Molecular Construction
N-term
Insulin (F25-A54&G85-N105)
Accession # P01317
C-term
Synonyms
Insulin; INS; IDDM; ILPR; IRDN; MODY10
AA Sequence

AFVNQHLCGSHLVEALYLVCGERGFFYTPKA&GIVEQCCASVCSLYQLENYCN

Molecular Weight

Approximately 6 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 10 mM Citric acid, pH 2.0-3.0.

Endotoxin Level

< 0.1 EU/μg of protein by gel clotting method

Reconstitution

It is not recommended to reconstitute to a concentration less than 1mg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Insulin Protein, Bovine Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Insulin Protein, Bovine
Cat. No.:
HY-P701240
Quantity:
MCE Japan Authorized Agent: