Insulin Protein, Bovine

Insulin Protein regulates glucose metabolism in the body. It binds to insulin receptors, activating signaling pathways that facilitate glucose uptake and storage. Insulin Protein also regulates lipid metabolism and protein synthesis. Understanding its functions is crucial for developing treatments for diabetes and metabolic disorders. Insulin Protein, Bovine is a recombinant protein dimer complex containing bovine-derived Insulin protein, expressed by P. pastoris, with tag free. Insulin Protein, Bovine, has molecular weight of ~6 kDa.

Insulin, a pivotal hormone in glucose homeostasis, plays a crucial role in reducing blood glucose concentration. Its actions extend beyond glycemic control, as it enhances cell permeability to monosaccharides, amino acids, and fatty acids. Furthermore, insulin facilitates metabolic processes such as glycolysis, the pentose phosphate cycle, and glycogen synthesis in the liver, contributing to overall energy regulation. Structurally, insulin is composed of a heterodimeric arrangement, consisting of a B chain and an A chain connected by two disulfide bonds. The multifaceted functions of insulin underscore its significance in orchestrating metabolic responses and maintaining physiological balance.

Measure by its ability by a dose-response proliferation assay using human MCF7 epithelial cells. The ED50 for this effect is <1.0 μg/mL. The specific activity of this protein is > 1.0 × 10³ IU/mg. (It is recommended to experimentally determine the optimal concentration for each specific application by performing a dose response assay.)

Bovine

P. pastoris

Tag Free

P01317 (F25-A54&G85-N105)

/

AFVNQHLCGSHLVEALYLVCGERGFFYTPKA&GIVEQCCASVCSLYQLENYCN

Approximately 6 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of 10 mM Citric acid, pH 2.0-3.0.

< 0.1 EU/μg of protein by gel clotting method

It is not recommended to reconstitute to a concentration less than 1mg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.