1. Recombinant Proteins
  2. Receptor Proteins
  3. Cell Adhesion Molecules (CAMs)
  4. Integrin
  5. Integrin alpha 2B beta 3
  6. Integrin alpha 2B beta 3 Protein, Human (HEK293, His)

Integrin alpha 2B beta 3 Protein, Human (HEK293, His)

Cat. No.: HY-P77716
SDS COA Handling Instructions

Integrin alpha 2B beta 3 Protein, found on platelets, plays a crucial role in blood clotting. It binds to fibrinogen, facilitating platelet aggregation and forming stable clots. Understanding the functions of Integrin alpha 2B beta 3 Protein can help in developing therapies for clotting disorders and improving hemostasis. Integrin alpha 2B beta 3 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha 2B beta 3 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha 2B beta 3 Protein, Human (HEK293, His), has molecular weight of 95-115 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
20 μg $170 In-stock
50 μg $320 In-stock
100 μg $515 In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Integrin alpha 2B beta 3 Protein, found on platelets, plays a crucial role in blood clotting. It binds to fibrinogen, facilitating platelet aggregation and forming stable clots. Understanding the functions of Integrin alpha 2B beta 3 Protein can help in developing therapies for clotting disorders and improving hemostasis. Integrin alpha 2B beta 3 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha 2B beta 3 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha 2B beta 3 Protein, Human (HEK293, His), has molecular weight of 95-115 kDa.

Background

Integrin alpha-IIb/beta-3 serves as a versatile receptor, recognizing a diverse range of ligands such as fibronectin, fibrinogen, plasminogen, prothrombin, thrombospondin, and vitronectin. Its recognition motif includes the sequence R-G-D and the specific sequence H-H-L-G-G-G-A-K-Q-A-G-D-V in fibrinogen gamma chain. Upon activation, integrin alpha-IIb/beta-3 mediates platelet-platelet interaction through the binding of soluble fibrinogen, initiating rapid platelet aggregation that forms a physical plug on the ruptured endothelial cell surface. This heterodimeric integrin comprises an alpha subunit, consisting of heavy and light chains linked by a disulfide bond, and a beta subunit (beta-3) that associates with the alpha-IIb subunit. Integrin alpha-IIb/beta-3 engages in direct interactions with various proteins, including RNF181, CIB1, CIB2, CIB3, and CIB4, with some interactions being calcium and magnesium-dependent. Additionally, it interacts with PPIA/CYPA in a manner influenced by reactive oxygen species (ROS), PPIase activity, and thrombin presence.

Species

Human

Source

HEK293

Tag

C-His

Accession

P08514 (L32-R993)&P05106 (G27-D718)

Gene ID

3674  [NCBI]&3690  [NCBI]

Synonyms
ITGA2B&ITGB3; ITGA2B; ITGB3
AA Sequence

ITGA2B LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEER <br/>ITGB3 GPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLGSPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRPDDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFGAFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLSMDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFGKITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD

Molecular Weight

95-115 kDa

Purity

Greater than 95% as determined by Tris-Bis PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Integrin alpha 2B beta 3 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Integrin alpha 2B beta 3 Protein, Human (HEK293, His)
Cat. No.:
HY-P77716
Quantity:
MCE Japan Authorized Agent: