1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Macrophage CD Proteins Monocyte CD Proteins Dendritic Cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. CD11c Integrin
  5. Integrin alpha X beta 2
  6. Integrin alpha X beta 2 Protein, Human (HEK293, His)

Integrin alpha X beta 2 Protein, Human (HEK293, His)

Cat. No.: HY-P73863
Data Sheet Handling Instructions Technical Support

Integrin α-X/β-2 is a receptor for fibrinogen that recognizes GPR sequences. It plays a key role in inflammatory responses, particularly in monocyte adhesion and chemotaxis. Integrin alpha X beta 2 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha X beta 2 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha X beta 2 Protein, Human (HEK293, His), has molecular weight of 130-150 kDa (ITGAX) & 85-96 kDa (ITGB2), respectively.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg USD 50 In-stock
10 μg USD 85 In-stock
50 μg USD 235 In-stock
100 μg USD 400 In-stock
> 100 μg   Get quote  

Get it by tomorrow May 1 for select sizes. Order within 10 hrs 0 mins.

* Please select Quantity before adding items.

Integrin alpha X beta 2 Protein, Human (HEK293, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Integrin α-X/β-2 is a receptor for fibrinogen that recognizes GPR sequences. It plays a key role in inflammatory responses, particularly in monocyte adhesion and chemotaxis. Integrin alpha X beta 2 Protein, Human (HEK293, His) is a recombinant protein dimer complex containing human-derived Integrin alpha X beta 2 protein, expressed by HEK293 , with C-His labeled tag. Integrin alpha X beta 2 Protein, Human (HEK293, His), has molecular weight of 130-150 kDa (ITGAX) & 85-96 kDa (ITGB2), respectively.

Background

The Integrin alpha-X/beta-2 protein serves as a receptor for fibrinogen, recognizing the G-P-R sequence in its ligands. Crucial for cell-cell interactions during inflammatory responses, Integrin alpha-X/beta-2 plays a particularly significant role in monocyte adhesion and chemotaxis. Structurally, it forms a heterodimer, consisting of an alpha and a beta subunit, with the alpha-X subunit associating with the beta-2 subunit. This receptor's recognition of fibrinogen and its involvement in inflammatory processes underscore its importance in facilitating immune responses, emphasizing its role in the regulation of monocyte functions and cell migration during inflammation.

Biological Activity

Immobilized Human ITGAX&ITGB2, His Tag at 1 μg/mL (100 μl/well) on the plate. Dose response curve for Anti-ITGB2 Antibody, hFc Tag with the EC50 of 26.8 ng/mL determined by ELISA.

Species

Human

Source

HEK293

Tag

C-His

Accession

P20702 (F20-P1107)&P05107 (Q23-N700)

Gene ID

3687  [NCBI]&3689  [NCBI]

Synonyms
Integrin alpha X beta 2; CD11c; ITGAX; CD18; ITGB2
AA Sequence

A1:
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHRLFHASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKELNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYKVHNPTP
A2:
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVLPFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQFQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNLYKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDHNALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPITFQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCRDQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPN

Molecular Weight

130-150 kDa(ITGAX)&85-96 kDa(ITGB2)

Purity
  • Greater than 90% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in PBS. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Integrin alpha X beta 2 Protein, Human (HEK293, His)
Cat. No.:
HY-P73863
Quantity:
MCE Japan Authorized Agent: