ISG15/UCRP Protein, Human (C-His)

ISG15/UCRP Protein, Human (C-6*His) is the recombinant human-derived ISG15/UCRP, expressed by E. coli , with C-6*His labeled tag. ,

Measured in a cell proliferation assay using PANC-1 cells. The ED₅₀ for this effect is typically 16.47 ng/mL.

• 
  Measured in a cell proliferation assay using PANC-1 cells. The ED₅₀ for this effect is typically 16.47 ng/mL, corresponding to a specific activity is 6.07×10⁴ units/mg.

Human

E. coli

C-6*His

AAH09507.1 (G2-G157)

9636

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Approximately 17.0 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 50 mM Tris-HCL, pH 8.0, 5% trehalose, 5% mannitol and 0.01% Tween80.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.