2. Recombinant Proteins
  3. Ubiquitin Related Proteins
  4. Ubiquitin/UBLs
  5. Interferon-Stimulated Gene 15 (ISG15)
  6. ISG15/UCRP Protein, Human (His)

ISG15/UCRP Protein, Human (His)

Cat. No.: HY-P70149
COA Handling Instructions

ISG15/UCRP Protein, Human (His) is the recombinant human-derived ISG15/UCRP protein, expressed by E. coli , with C-6*His labeled tag. The total length of ISG15/UCRP Protein, Human (His) is 156 a.a., with molecular weight of ~16.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg $49 In-stock
50 μg $150 In-stock
100 μg   Get quote  
or Bulk Inquiry

* Please select Quantity before adding items.

Top Publications Citing Use of Products

  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

ISG15/UCRP Protein, Human (His) is the recombinant human-derived ISG15/UCRP protein, expressed by E. coli , with C-6*His labeled tag. The total length of ISG15/UCRP Protein, Human (His) is 156 a.a., with molecular weight of ~16.0 kDa.
Species

Human
Source

E. coli
Tag

C-6*His
Accession

AAH09507.1 (G2-G157)
Gene ID
Molecular Construction
N-term
ISG15 (G2-G157)
Accession # AAH09507.1
6*His
C-term
Synonyms
rHuISG15/UCRP, His; Ubiquitin-Like Protein ISG15; Interferon-Induced 15 kDa Protein; Interferon-Induced 17 kDa Protein; IP17; Ubiquitin Cross-Reactive Protein; hUCRP; ISG15; G1P2; UCRP
AA Sequence

GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGG

Molecular Weight

Approximately 16.0 kDa
Purity

Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution.
Formulation

Supplied as a 0.2 μm filtered solution of 50 mM HEPES, 100 mM NaCl, pH 8.0.
Endotoxin Level

<1 EU/μg, determined by LAL method.
Storage & Stability

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.
Shipping

Shipping with dry ice.
Documentation

COA (218 KB)

Handling Instructions (2659 KB)

ISG15/UCRP Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

  

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

      

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
ISG15/UCRP Protein, Human (His)
Cat. No.:
HY-P70149
Quantity:
MCE Japan Authorized Agent:

Request for HNMR Report

Please fill out this form to request the QC report. We will send it to your Email address shortly.

Your information is safe with us. * Required Fields.

Product Name

  

Lot #

Applicant Name *

 

Country or Region *

Email Address *

     

Phone Number *

 

Organization Name *

Remarks

Request for HNMR Report

We have received your request and will respond to you as soon as possible.