ITM2B Protein, Human (HEK293, His)

The ITM2B protein regulates amyloid beta A4 precursor protein (APP) processing by inhibiting amyloid beta peptide aggregation and fibril deposition. In addition to its effects on the amyloid-β pathway, ITM2B also contributes to neurite outgrowth, affecting neurobiological processes. ITM2B Protein, Human (HEK293, His) is the recombinant human-derived ITM2B protein, expressed by HEK293 , with C-6*His labeled tag. The total length of ITM2B Protein, Human (HEK293, His) is 191 a.a., with molecular weight of 29-33 kDa.

ITM2B assumes a regulatory role in the intricate processing of the amyloid-beta A4 precursor protein (APP) and serves as an inhibitor, effectively impeding the aggregation and fibril deposition of amyloid-beta peptides. Beyond its influence on amyloid-beta pathways, ITM2B plays a pivotal role in the induction of neurite outgrowth, contributing to neurobiological processes. Furthermore, ITM2B acts as a protease inhibitor by strategically blocking access of secretases to critical APP cleavage sites. In its mature form (mBRI2), ITM2B serves as a potent modulator of APP processing, resulting in a substantial reduction in the secretion of secretase-processed amyloid-beta protein 40 and amyloid-beta protein 42, thereby highlighting its multifaceted role in cellular homeostasis.

Human

HEK293

C-6*His

Q9Y287 (Y76-S266 )

9445  [NCBI]

YKYFALQPDDVYYCGIKYIKDDVILNEPSADAPAALYQTIEENIKIFEEEEVEFISVPVPEFADSDPANIVHDFNKKLTAYLDLNLDKCYVIPLNTSIVMPPRNLLELLINIKAGTYLPQSYLIHEHMVITDRIENIDHLGFFIYRLCHDKETYKLQRRETIKGIQKREASNCFAIRHFENKFAVETLICS

29-33 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.