1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protein Tyrosine Kinases
  4. Janus Kinase 1 (JAK1)
  5. JAK1 Protein, Human (sf9, His)

JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag. The total length of JAK1 Protein, Human (sf9, His) is 292 a.a., with molecular weight of 30-33 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag. The total length of JAK1 Protein, Human (sf9, His) is 292 a.a., with molecular weight of 30-33 kDa.

Background

JAK1 protein, a non-receptor tyrosine kinase, plays a crucial role in the IFN-alpha/beta/gamma signal pathway, as evidenced by various studies. It acts as a kinase partner for the interleukin (IL)-2 receptor and IL-10 receptor, demonstrating its versatility in different cytokine signaling pathways. Moreover, JAK1 serves as a kinase partner for the type I interferon receptor IFNAR2, and upon interferon binding to the IFNAR1-IFNAR2 heterodimer, it phosphorylates and activates IFNAR2, creating docking sites for STAT proteins. JAK1 not only directly phosphorylates STAT proteins but also activates STAT signaling by transactivating other JAK kinases associated with signaling receptors. This multifaceted involvement positions JAK1 as a central player in the intricate network of signaling pathways, contributing to the regulation of immune responses and cellular processes.

Species

Human

Source

sf9 insect cells

Tag

N-6*His

Accession

P23458 (A561-N852)

Gene ID
Molecular Construction
N-term
His
JAK1 (A561-N852)
Accession # P23458
C-term
Synonyms
JAK1; JAK-1; JAK1A; JAK1B; Jak1
AA Sequence

AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQN

Molecular Weight

Approximately 36 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Solution

Formulation

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 500 mM NaCl, pH 8.0, 2mM TCEP, 20% Glycerol.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

N/A.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

JAK1 Protein, Human (sf9, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JAK1 Protein, Human (sf9, His)
Cat. No.:
HY-P78739
Quantity:
MCE Japan Authorized Agent: