JAK1 Protein, Human (sf9, His)

JAK1 protein is a non-receptor tyrosine kinase that plays a crucial role in IFN-α/β/γ signaling and serves as a kinase partner for IL-2 and IL-10 receptors. It cooperates with the type I interferon receptor IFNAR2 to phosphorylate and activate IFNAR2 upon interferon binding to IFNAR1-IFNAR2. JAK1 Protein, Human (sf9, His) is the recombinant human-derived JAK1 protein, expressed by sf9 insect cells , with N-His labeled tag. The total length of JAK1 Protein, Human (sf9, His) is 292 a.a., with molecular weight of 30-33 kDa.

JAK1 protein, a non-receptor tyrosine kinase, plays a crucial role in the IFN-alpha/beta/gamma signal pathway, as evidenced by various studies. It acts as a kinase partner for the interleukin (IL)-2 receptor and IL-10 receptor, demonstrating its versatility in different cytokine signaling pathways. Moreover, JAK1 serves as a kinase partner for the type I interferon receptor IFNAR2, and upon interferon binding to the IFNAR1-IFNAR2 heterodimer, it phosphorylates and activates IFNAR2, creating docking sites for STAT proteins. JAK1 not only directly phosphorylates STAT proteins but also activates STAT signaling by transactivating other JAK kinases associated with signaling receptors. This multifaceted involvement positions JAK1 as a central player in the intricate network of signaling pathways, contributing to the regulation of immune responses and cellular processes.

Human

sf9 insect cells

N-6*His

P23458 (A561-N852)

3716  [NCBI]

AQEWQPVYPMSQLSFDRILKKDLVQGEHLGRGTRTHIYSGTLMDYKDDEGTSEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDVENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLLLAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGTTLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQN

Approximately 36 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 50 mM Tris-HCL, 500 mM NaCl, pH 8.0, 2mM TCEP, 20% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.