JAM-A/CD321 Protein, Rat (HEK293, His)

The JAM-A/CD321 protein is critical for the formation of tight junctions in epithelial cells, participating in early junction development and recruiting PARD3. However, the formation of PARD6-PARD3 complex may hinder PARD3-JAM1 interaction, thus preventing tight junction assembly. JAM-A/CD321 Protein, Rat (HEK293, His) is the recombinant rat-derived JAM-A/CD321 protein, expressed by HEK293 , with C-His labeled tag. The total length of JAM-A/CD321 Protein, Rat (HEK293, His) is 212 a.a., with molecular weight of 25 & 28 kDa, respectively.

The JAM-A/CD321 protein plays a crucial role in the formation of tight junctions in epithelial cells. It is involved in the early stages of cell junction development and recruits PARD3. However, the formation of the PARD6-PARD3 complex may hinder the interaction between PARD3 and JAM1, leading to the prevention of tight junction assembly. Moreover, JAM-A/CD321 is involved in regulating the transmigration of monocytes, which is essential for maintaining the integrity of the epithelial barrier. It also acts as a ligand for integrin alpha-L/beta-2, facilitating the transmigration of memory T-cells and neutrophils. Additionally, JAM-A/CD321 interacts with the ninth PDZ domain of MPDZ and the first PDZ domain of PARD3, with the association between PARD3 and PARD6B possibly disrupting this interaction. Furthermore, it interacts with ITGAL (via I-domain).

Measured by the ability of the immobilized protein to inhibit the adhesion of Vitronectin on HUVEC cells. The ED₅₀ for this effect is 0.1574 μg/mL in the presence of 10 ng/mL Vitronectin. Corresponding to a specific activity is 6353.24 U/mg.

• 
  Measured by the ability of the immobilized protein to inhibit the adhesion of Vitronectin on HUVEC cells. The ED₅₀ for this effect is 0.1574 μg/mL in the presence of 10 ng/mL Vitronectin. Corresponding to a specific activity is 6353.24 U/mg.

Rat

HEK293

C-6*His

Q9JHY1 (K27-G238)

116479  [NCBI]

KGSVYSPQTAVQVPENDSVKLPCIYSGFSSPRVEWKFVQGSTTALVCYNNQITVPYADRVTFSSSGITFSSVTRKDNGEYTCMVSEDGGQNYGEVSIHLTVLVPPSKPTVSIPSSVTIGNRAVLTCSEHDGSPPSEYSWFKDGVPMLTADAKKTRAFINSSYTIDPKSGDLVFDPVSAFDSGEYYCEAQNGYGTAMRSEAVRMEAVELNVGG

Approximately 25&28 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.