1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. Epithelial cell CD Proteins Endothelial cell CD Proteins Cell Adhesion Molecules (CAMs)
  4. JAM-B/CD322 Immunoglobulin-like Cell Adhesion Molecules
  5. JAM-B/CD322
  6. JAM-B/CD322 Protein, Human (HEK293, His)

JAM-B/CD322 protein and JAM3 coordinate heterotypic cell interactions and regulate different processes. In the bone marrow, it retains hematopoietic stem cells on stromal cells and aids leukocyte extravasation by promoting transmigration, tethering, and rolling. JAM-B/CD322 Protein, Human (HEK293, His) is the recombinant human-derived JAM-B/CD322 protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

JAM-B/CD322 protein and JAM3 coordinate heterotypic cell interactions and regulate different processes. In the bone marrow, it retains hematopoietic stem cells on stromal cells and aids leukocyte extravasation by promoting transmigration, tethering, and rolling. JAM-B/CD322 Protein, Human (HEK293, His) is the recombinant human-derived JAM-B/CD322 protein, expressed by HEK293 , with C-6*His labeled tag.

Background

JAM-B/CD322 protein, a junctional adhesion protein, intricately orchestrates heterotypic cell-cell interactions with its corresponding receptor, JAM3, thereby regulating diverse cellular processes as substantiated by various studies. Its involvement in the homing and mobilization of hematopoietic stem and progenitor cells within the bone marrow underscores its crucial role in this physiological context. Positioned on the surface of bone marrow stromal cells, JAM-B/CD322 contributes significantly to the retention of hematopoietic stem and progenitor cells expressing JAM3. Moreover, this protein assumes a central role in the extravasation of leukocytes by not only facilitating transmigration but also mediating tethering and rolling of leukocytes along the endothelium. The tethering and rolling processes are contingent upon the binding of JAM2 to the integrin alpha-4/beta-1. Beyond hematopoiesis, JAM-B/CD322 extends its influence to spermatogenesis, where interactions between JAM2 and JAM3 in Sertoli and germ cells respectively play a pivotal role in anchoring germ cells onto Sertoli cells and assembling cell polarity complexes during spermatid differentiation. Additionally, it functions as an inhibitory somatodendritic cue, preventing the myelination of non-axonal parts of neurons, contributes to myocyte fusion during myogenesis, and may also play a role in angiogenesis.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P57087-1 (F29-N236)

Gene ID
Molecular Construction
N-term
JAM-A (F29-N236)
Accession # P57087-1
6*His
C-term
Synonyms
rHuJunctional adhesion molecule B/JAM-B, His; Junctional Adhesion Molecule B; JAM-B; Junctional Adhesion Molecule 2; JAM-2; Vascular Endothelial Junction-Associated Molecule; VE-JAM; CD322; JAM2; C21orf43; VEJAM
AA Sequence

FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLN

Molecular Weight

35-39 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US;may vary elsewhere.

Documentation

JAM-B/CD322 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
JAM-B/CD322 Protein, Human (HEK293, His)
Cat. No.:
HY-P70385
Quantity:
MCE Japan Authorized Agent: