JTB Protein, Human (HEK293, Fc)

JTB proteins are critical for normal cytokinesis progression, regulate cell proliferation, and may serve as components of the chromosomal passenger complex (CPC) during mitosis. It interacts with key CPC components, affects AURKB activity, and exhibits anti-apoptotic properties, inhibiting TGFB1-induced apoptosis. JTB Protein, Human (HEK293, Fc) is the recombinant human-derived JTB protein, expressed by HEK293 , with C-mFc labeled tag. The total length of JTB Protein, Human (HEK293, Fc) is 75 a.a., with molecular weight of ~38 kDa.

JTB protein is indispensable for the normal progression of cytokinesis during mitosis and plays a crucial role in regulating cell proliferation. It is implicated as a potential component of the chromosomal passenger complex (CPC), a pivotal regulator of mitosis with essential functions at the centromere. The CPC complex is instrumental in ensuring accurate chromosome alignment and segregation, as well as participating in chromatin-induced microtubule stabilization and spindle assembly. JTB interacts with key components of the CPC, including AURKA, AURKB, BIRC5, and INCENP, potentially influencing AURKB activity. Moreover, JTB exhibits anti-apoptotic properties, inhibiting apoptosis induced by TGFB1, and its overexpression is associated with mitochondrial changes, leading to mitochondrial swelling and reduced membrane potential. These multifaceted roles highlight JTB's involvement in intricate cellular processes crucial for mitotic fidelity and cell survival.

Human

HEK293

C-mFc

O76095-1 (E31-L105)

10899  [NCBI]

EAPVQEEKLSASTSNLPCWLVEEFVVAEECSPCSNFRAKTTPECGPTGYVEKITCSSSKRNEFKSCRSALMEQRL

Approximately 39 kDa due to the glycosylation

• 
  Greater than 90% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.