Kallikrein-10 Protein, Human (HEK293, His)

Kallikrein-10 protein has a tumor suppressive effect, especially in breast and prostate cancer, by inhibiting NES1. This emphasizes its importance in mitigating tumorigenesis in these specific types of cancer. Kallikrein-10 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-10 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-10 Protein, Human (HEK293, His) is 246 a.a., with molecular weight of ~34.0 kDa.

Kallikrein-10 (KLK10) protein is implicated in a tumor-suppressor role, particularly in breast and prostate cancer, where it functions as NES1 (kallikrein-related peptidase 10). Serval researches indicatethat KLK10, when assuming the role of NES1, acts to suppress tumor development in these specific cancer types. This suggests that KLK10 may play a crucial role in regulating cellular processes that contribute to the inhibition of tumor growth in breast and prostate tissues. Further exploration is warranted to elucidate the specific mechanisms by which KLK10 exerts its tumor-suppressor function and to understand its potential therapeutic implications in the context of breast and prostate cancer.

Human

HEK293

C-6*His

O43240 (A31-N276)

5655  [NCBI]

AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

Approximately 34.0 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.