1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. Kallikrein-10 Protein, Human (HEK293, His)

Kallikrein-10 protein has a tumor suppressive effect, especially in breast and prostate cancer, by inhibiting NES1. This emphasizes its importance in mitigating tumorigenesis in these specific types of cancer. Kallikrein-10 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-10 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-10 Protein, Human (HEK293, His) is 246 a.a., with molecular weight of ~34.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Kallikrein-10 protein has a tumor suppressive effect, especially in breast and prostate cancer, by inhibiting NES1. This emphasizes its importance in mitigating tumorigenesis in these specific types of cancer. Kallikrein-10 Protein, Human (HEK293, His) is the recombinant human-derived Kallikrein-10 protein, expressed by HEK293 , with C-6*His labeled tag. The total length of Kallikrein-10 Protein, Human (HEK293, His) is 246 a.a., with molecular weight of ~34.0 kDa.

Background

Kallikrein-10 (KLK10) protein is implicated in a tumor-suppressor role, particularly in breast and prostate cancer, where it functions as NES1 (kallikrein-related peptidase 10). Serval researches indicatethat KLK10, when assuming the role of NES1, acts to suppress tumor development in these specific cancer types. This suggests that KLK10 may play a crucial role in regulating cellular processes that contribute to the inhibition of tumor growth in breast and prostate tissues. Further exploration is warranted to elucidate the specific mechanisms by which KLK10 exerts its tumor-suppressor function and to understand its potential therapeutic implications in the context of breast and prostate cancer.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

O43240 (A31-N276)

Gene ID
Molecular Construction
N-term
Kallikrein-10 (A31-N276)
Accession # O43240
6*His
C-term
Synonyms
rHuKallikrein-10/KLK10, His ; Kallikrein-10; Normal Epithelial Cell-Specific 1; Protease Serine-Like 1; KLK10; NES1; PRSSL1
AA Sequence

AEAALLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTAAHCGNKPLWARVGDDHLLLLQGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN

Molecular Weight

Approximately 34.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

Kallikrein-10 Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Kallikrein-10 Protein, Human (HEK293, His)
Cat. No.:
HY-P70143
Quantity:
MCE Japan Authorized Agent: