Kallikrein-7 Protein, Mouse (HEK293, His)

Kallikrein-7 is an important contributor to skin integrity and may catalyze the degradation of intercellular adhesive structures that are critical for continuous cell shedding.Kallikrein-7 exhibits cleavage activity against insulin A and B chains, with specificity for aromatic residues at position P1 indicating versatility in substrate recognition.Kallikrein-7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Kallikrein-7 protein, expressed by HEK293 , with C-6*His labeled tag.

The Kallikrein-7 protein emerges as a significant contributor to the maintenance of skin integrity, potentially catalyzing the degradation of intercellular cohesive structures within the cornified layer. This activity is likely crucial for the continuous shedding of cells from the skin surface. With a specificity for amino acid residues featuring aromatic side chains in the P1 position, Kallikrein-7 exhibits cleavage activity on insulin A and B chains at specific residues, suggesting its versatility in substrate recognition. Moreover, the protein could play a role in the activation of precursors to inflammatory cytokines, implying a potential involvement in the regulation of inflammatory processes. The multifaceted functions of Kallikrein-7 underscore its importance in skin physiology and its potential contributions to both structural integrity and inflammatory responses, warranting further exploration into its specific molecular mechanisms.

Mouse

HEK293

C-6*His

Q91VE3 (Q22-R249)

23993  [NCBI]

QGERIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQVQLGSDKIGDQSAQKIKATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEPPGTSCTVSGWGTTTSPDVTFPSDLMCSDVKLISSRECKKVYKDLLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMKTHR

28-35 kDa

Greater than 95% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.