1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. FGF Family
  4. Fibroblast Growth Factor
  5. FGF-10
  6. KGF-2/FGF-10 Protein, Human (169a.a)

KGF-2/FGF-10 Protein, Human (169a.a) is a heparin-binding protein that binds to FGF2 IIIb and FGFR1III-b receptors, promotes the growth, proliferation, and differentiation of epithelial cells and can enhance corneal wound healing.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
250 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

  • References

Description

KGF-2/FGF-10 Protein, Human (169a.a) is a heparin-binding protein that binds to FGF2 IIIb and FGFR1III-b receptors, promotes the growth, proliferation, and differentiation of epithelial cells and can enhance corneal wound healing.

Background

Keratinocyte growth factor-2 (KGF-2), also called fibroblast growth factor-10 (FGF-10), is a soluble 170-amino-acid polypeptide secreted by fibroblasts and endothelial cells acting primarily on epithelial cells. Its functions mainly mediated by FGF-2 IIIb receptor, a transmembrane receptor, expressed exclusively by epithelial cells. KGF-2 promotes the growth, proliferation, and differentiation of epithelial cells, with promising effects in treating epithelial damage. KGF-2 enhances corneal wound healing in a rabbit model of carbon dioxide laser-induced corneal injury[1]. Keratinocyte growth factor-2 (KGF-2) is a 20-kD heparin-binding protein, and also binds to FGFR1III-b, which may explain the severely impaired lung development of FGF-10 null mice[2].

Biological Activity

Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is ≤84.07 ng/mL, corresponding to a specificactivity is ≥1.2×104 Unit/mg.

  • Measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells. The ED50 for this effect is 35.64 ng/mL, corresponding to a specificactivity is 2.806×104 Unit/mg.
Species

Human

Source

E. coli

Tag

Tag Free

Accession

O15520 (L40-S208)

Gene ID
Molecular Construction
N-term
FGF-10 (L40-S208)
Accession # O15520
C-term
Synonyms
rHuKGF-2/FGF-10; Fibroblast Growth Factor-10
AA Sequence

LGQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS

Molecular Weight

Approximately 19-22 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS or 20 mM PB, 150 mM NaCl, pH 7.4 or 10 mM Tris, 5% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 8.0 or 50 mM Tris-HCL, 300 mM NaCL, pH 7.4 or PBS , pH 7.4, 5-8 % trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
References

KGF-2/FGF-10 Protein, Human (169a.a) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KGF-2/FGF-10 Protein, Human (169a.a)
Cat. No.:
HY-P7048
Quantity:
MCE Japan Authorized Agent: