1. Recombinant Proteins
  2. CD Antigens Receptor Proteins
  3. NK Cell CD Proteins Killer-Cell Immunoglobulin-like Receptors
  4. CD158z/KIR3DL3 CD158z/KIR3DL3
  5. KIR3DL3/CD158z Protein, Human (HEK293, His)

KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag. The total length of KIR3DL3/CD158z Protein, Human (HEK293, His) is 297 a.a., with molecular weight of 40-50 KDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KIR3DL3/CD158z, on natural killer cells, potentially inhibits NK cell activity, contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating NK cell functions and maintaining immune homeostasis. KIR3DL3/CD158z Protein, Human (HEK293, His) is the recombinant human-derived KIR3DL3/CD158z protein, expressed by HEK293 , with C-His labeled tag. The total length of KIR3DL3/CD158z Protein, Human (HEK293, His) is 297 a.a., with molecular weight of 40-50 KDa.

Background

KIR3DL3, present on natural killer cells, acts as a receptor that potentially inhibits NK cell activity, thereby contributing to the prevention of cell lysis. This regulatory role underscores the significance of KIR3DL3 in modulating the functions of NK cells and maintaining immune homeostasis.

Biological Activity

Measured by its binding ability in a functional ELISA. Immobilized Human HHLA2 at 0.5 μg/mL (100μL/well) can bind Biotinylated human KIR3DL3. The ED50 for this effect is 39.78ng/mL.

  • Measured by its binding ability in a functional ELISA. Immobilized Human HHLA2 at 0.5μg/mL (100μL/well) can bind Biotinylated human KIR3DL3. The ED50 for this effect is 39.78ng/mL.
Species

Human

Source

HEK293

Tag

C-6*His

Accession

Q8N743/NP_703144.2 (Q26-L322)

Gene ID
Molecular Construction
N-term
CD158z (Q26-L322)
Accession # Q8N743/NP_703144.2
His
C-term
Synonyms
Killer cell immunoglobulin-like receptor 3DL3; CD158Z; KIR3DL7; KIRC1
AA Sequence

QDKPFLSAWPGTVVSEGQHVTLQCRSRLGFNEFSLSKEDGMPVPELYNRIFRNSFLMGPVTPAHAGTYRCCSSHPHSPTGWSAPSNPVVIMVTGVHRKPSLLAHPGPLVKSGETVILQCWSDVRFERFLLHREGITEDPLRLVGQLHDAGSQVNYSMGPMTPALAGTYRCFGSVTHLPYELSAPSDPLDIVVVGLYGKPSLSAQPGPTVQAGENVTLSCSSRSLFDIYHLSREAEAGELRLTAVLRVNGTFQANFPLGPVTHGGNYRCFGSFRALPHAWSDPSDPLPVSVTGNSRHL

Molecular Weight

Approximately 40-50 kDa due to the glycosylation.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KIR3DL3/CD158z Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KIR3DL3/CD158z Protein, Human (HEK293, His)
Cat. No.:
HY-P77042
Quantity:
MCE Japan Authorized Agent: