KLRB1F/CD161f Protein, Mouse (HEK293, Fc)

The KLRB1F/CD161f protein is thought to bind CLEC2I/Clr-g, activate natural killer cells and provide costimulation for IL-2 production and T cell proliferation. This dual function highlights its critical role in coordinating immune responses. KLRB1F/CD161f Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived KLRB1F/CD161f protein, expressed by HEK293 , with N-hFc labeled tag. The total length of KLRB1F/CD161f Protein, Mouse (HEK293, Fc) is 151 a.a., with molecular weight of 50-55 kDa.

The KLRB1F/CD161f Protein is known for its capability to bind CLEC2I/Clr-g, initiating the activation of natural killer cells or providing costimulation for IL-2 production and T-cell proliferation in response to antigen stimulation. This dual functionality underscores its role in orchestrating immune responses. Furthermore, KLRB1F/CD161f may play a role in the formation of the immunological synapse between T-cells and antigen-presenting dendritic cells, suggesting its involvement in the intricate molecular interactions that govern effective immune recognition and response.

Mouse

HEK293

N-hFc

Q8VD98 (Q67-V217)

232408  [NCBI]

QKPPIEKCSVAAQENRTELTGRSAILECPRYWHPHWNKCLFVSQISRPWAEGRDACSMEDAILLLIENKEELRFVQNLIKGKEQLFFIGLKYVQKEKIWKWIDGSILNPNLLRITGKDKENSCAIISHTEVFSDSCSSDNHWICQKTLIHV

Approximately 50-55 kDa due to the glycosylation.

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.