1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Hydrolases (EC 3)
  4. KRAS Protein, Human (G12S, His)

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. KRAS Protein, Human (G12S, His) is the recombinant human-derived KRAS, expressed by E. coli , with N-6*His labeled tag. ,

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

KRAS Protein, Human (G12S, His) Featured Recommendations:

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

KRAS protein is a key Ras family member that binds GDP/GTP and has intrinsic GTPase activity. Its critical role in regulating cell proliferation emphasizes its importance in cellular processes. KRAS Protein, Human (G12S, His) is the recombinant human-derived KRAS, expressed by E. coli , with N-6*His labeled tag. ,

Background

KRAS, a pivotal member of the Ras protein family, exhibits the ability to bind GDP/GTP and possesses intrinsic GTPase activity. Its crucial involvement in the regulation of cell proliferation underscores its significance in cellular processes. Notably, KRAS plays a prominent role in promoting oncogenic events, particularly in colorectal cancer (CRC), where it induces transcriptional silencing of tumor suppressor genes (TSGs) in a ZNF304-dependent manner. This multifaceted functionality highlights KRAS as a key player in cellular dynamics and emphasizes its relevance in both normal and pathological cellular processes.

Biological Activity

1.Biological activity has been tested in vitro. 2.Measured by its ability to catalyze 2m substrate GTP. which can be measured by absorbance at 620 nm that incubate at room temperature for 10 minutes. The specific activity is 716.25 nmo/min/mg.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

AAH13572.1 (T2-C185, G12S)

Gene ID
Synonyms
rHuKRAS-G12S, His; Ki-Ras; c-K-ras; KRAS2; RASK2; CFC2
AA Sequence

TEYKLVVVGASGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC

Molecular Weight

Approximately 25-30 kDa.

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or PBS, pH 7.4, 5% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KRAS Protein, Human (G12S, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KRAS Protein, Human (G12S, His)
Cat. No.:
HY-P70153
Quantity:
MCE Japan Authorized Agent: