KYAT1 Protein, Human (His)

The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.

KYAT1 protein plays a pivotal role in cellular metabolism by catalyzing the irreversible transamination of the L-tryptophan metabolite L-kynurenine, leading to the formation of kynurenic acid (KA). This enzymatic activity is integral to the tryptophan catabolic pathway, where kynurenic acid serves as an intermediate. Notably, kynurenic acid acts as a broad-spectrum antagonist for various receptors, including the three ionotropic excitatory amino acid receptors. Beyond its involvement in tryptophan metabolism, KYAT1 also plays a role in the biotransformation of cysteine conjugates of specific halogenated alkenes and alkanes, contributing to the generation of reactive metabolites. Additionally, KYAT1 catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, leading to the cleavage of the C-S or C-Se bond.

Measured by its ability to hydrolyze 5mΜ se - methylselenopysteine that incubate at 37°C for 20 min. The specific activity is 162.351 pmol/min/μg.

Human

E. coli

C-6*His

Q16773-2 (M1-L372)

883  [NCBI]

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

Approximately 42 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCL, 500 mM NaCl, pH 8.0, 6% trehalose.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O.

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.