KYAT1 Protein, Human (His)

The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.

KYAT1 protein plays a pivotal role in cellular metabolism by catalyzing the irreversible transamination of the L-tryptophan metabolite L-kynurenine, leading to the formation of kynurenic acid (KA). This enzymatic activity is integral to the tryptophan catabolic pathway, where kynurenic acid serves as an intermediate. Notably, kynurenic acid acts as a broad-spectrum antagonist for various receptors, including the three ionotropic excitatory amino acid receptors. Beyond its involvement in tryptophan metabolism, KYAT1 also plays a role in the biotransformation of cysteine conjugates of specific halogenated alkenes and alkanes, contributing to the generation of reactive metabolites. Additionally, KYAT1 catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, leading to the cleavage of the C-S or C-Se bond.

Human

E. coli

C-6*His

Q16773-2 (M1-L372)

883  [NCBI]

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

Greater than 90% as determined by reducing SDS-PAGE.

<1 EU/μg, determined by LAL method.