1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Transferases (EC 2)
  4. KYAT1 Protein, Human (His)

The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
500 μg In-stock
1 mg In-stock
> 1 mg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The KYAT1 protein catalyzes the irreversible ammonia action of L-kynurenine to produce kynurenic acid (KA), which is an intermediate in the tryptophan catabolic pathway and a broad-spectrum antagonist of excitatory amino acid receptors. KYAT1 Protein, Human (His) is the recombinant human-derived KYAT1 protein, expressed by E. coli , with C-6*His labeled tag.

Background

KYAT1 protein plays a pivotal role in cellular metabolism by catalyzing the irreversible transamination of the L-tryptophan metabolite L-kynurenine, leading to the formation of kynurenic acid (KA). This enzymatic activity is integral to the tryptophan catabolic pathway, where kynurenic acid serves as an intermediate. Notably, kynurenic acid acts as a broad-spectrum antagonist for various receptors, including the three ionotropic excitatory amino acid receptors. Beyond its involvement in tryptophan metabolism, KYAT1 also plays a role in the biotransformation of cysteine conjugates of specific halogenated alkenes and alkanes, contributing to the generation of reactive metabolites. Additionally, KYAT1 catalyzes the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, leading to the cleavage of the C-S or C-Se bond.

Biological Activity

Measured by its ability to hydrolyze 5mΜ se - methylselenopysteine that incubate at 37°C for 20 min. The specific activity is 162.351 pmol/min/μg.

Species

Human

Source

E. coli

Tag

C-6*His

Accession

Q16773-2 (M1-L372)

Gene ID

883  [NCBI]

Molecular Construction
N-term
KYAT1 (M1-L372)
Accession # Q16773
6*His
C-term
Synonyms
KYAT1; CCBL1; Kynurenine--oxoglutarate transaminase 1; EC 2.6.1.7; Cysteine-S-conjugate beta-lyase; EC 4.4.1.13; Glutamine transaminase K; GTK; Glutamine--phenylpyruvate transaminase; EC 2.6.1.64; Kynurenine aminotransferase 1; Kynurenine aminotransferase I; KATI; Kynurenine--oxoglutarate transaminase I
AA Sequence

MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVEL

Molecular Weight

Approximately 42 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.22 μm filtered solution of 20 mM Tris-HCL, 500 mM NaCl, pH 8.0, 6% trehalose.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

KYAT1 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
KYAT1 Protein, Human (His)
Cat. No.:
HY-P71533
Quantity:
MCE Japan Authorized Agent: