L-Selectin/CD62L Protein, Rat (HEK293, His)

L-selectin/CD62L is a calcium-dependent lectin that binds adjacent glycoproteins to allow lymphocyte adhesion to endothelial cells in peripheral lymph nodes. This encourages leukocytes to bind and roll within endothelial tissue. L-Selectin/CD62L Protein, Rat (HEK293, His) is the recombinant rat-derived L-Selectin/CD62L protein, expressed by HEK293 , with C-His labeled tag.

L-Selectin/CD62L, a calcium-dependent lectin, plays a pivotal role in cell adhesion by binding to glycoproteins on adjacent cells. It facilitates the adherence of lymphocytes to the endothelial cells of high endothelial venules in peripheral lymph nodes, promoting the initial tethering and rolling of leukocytes within endothelial tissues. The recruitment and rolling of leukocytes are dependent on interactions with SELPLG/PSGL1 and PODXL2, where the sialyl Lewis X glycan modification of SELPLG and PODXL2, along with tyrosine sulfation modifications of SELPLG, are essential. Notably, the sulfation on 'Tyr-51' of SELPLG emerges as a critical factor for the binding of L-Selectin, underscoring its importance in facilitating cellular interactions and adhesive processes.

Measured by the ability of the immobilized protein to support the adhesion of U937 human histiocytic lymphoma cells. When 5×10⁴ cells/well are added to Rat L-Selectin coated plates (10 μg/mL, 100 μL/well), will induce 52.78% adhesion on U937 cells after 1 hour at 37°C.

Rat

HEK293

C-His

P30836 (W39-N332)

29259  [NCBI]

WTYHYSERSMNWENARKFCKHNYTDLVAIQNKREIEYLEKTLPKNPTYYWIGIRKIGKTWTWVGTNKTLTKEAENWGTGEPNNKKSKEDCVEIYIKRERDSGKWNDDACHKRKAALCYTASCQPESCNRHGECVETINNNTCICDPGYYGPQCQYVIQCEPLKAPELGTMNCIHPLGDFSFQSQCAFNCSEGSELLGNAKTECGASGNWTYLEPICQVIQCMPLAAPDLGTMECSHPLANFSFTSACTFTCSEETDLIGERKTVCRSSGSWSSPSPICQKTKRSFSKIKEGDYN

Approximately 43-55 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.