1. Recombinant Proteins
  2. Others
  3. LAG-3 Protein, Canine (HEK293, Flag, His)

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Canine (HEK293, Flag, His) is the recombinant canine-derived LAG-3 protein, expressed by HEK293 , with C-His, C-Flag labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LAG-3 (lymphocyte activation gene 3) protein is expressed on antigen-activated T cells and transmits inhibitory signals by binding to ligands such as FGL1. FGL1 is the main ligand responsible for the suppressive function of LAG3 T cells. LAG-3 Protein, Canine (HEK293, Flag, His) is the recombinant canine-derived LAG-3 protein, expressed by HEK293 , with C-His, C-Flag labeled tag.

Background

LAG-3 (Lymphocyte activation gene 3) protein is an inhibitory receptor expressed on antigen-activated T-cells, delivering inhibitory signals upon binding to ligands such as FGL1. Serving as a major ligand of LAG3, FGL1 is responsible for LAG3's T-cell inhibitory function. Following T-cell receptor (TCR) engagement, LAG3 associates with CD3-TCR in the immunological synapse, directly inhibiting T-cell activation. LAG3 may synergistically inhibit antigen-specific T-cell activation with PDCD1/PD-1, possibly acting as a coreceptor for PD-1. It negatively regulates the proliferation, activation, effector function, and homeostasis of both CD8(+) and CD4(+) T-cells. Constitutively expressed on a subset of regulatory T-cells (Tregs), LAG3 contributes to their suppressive function, mediating immune tolerance. Additionally, LAG3 acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation and binds to MHC class II (MHC-II), possibly functioning as a ligand for MHC-II on antigen-presenting cells, thereby promoting APC activation/maturation and driving Th1 immune responses.

Species

Canine

Source

HEK293

Tag

C-His;C-Flag

Accession

A0A8C0JP39 (P23-S441)

Gene ID

/

Synonyms
Lymphocyte activating 3
AA Sequence

PGSGTEVQVVWAQEGAPVQLPCSPTIPLQDVSLLRNAGVTWYHLPESGPAAPALSLRPAAPSARGPGPRSYVVLMRAPGGLRSGRPPLQPRVQLEERGLQRGDFSLWLRPARRADAGEYRAAVHLRDRSLACRLRLRVGQASMTASPPGALRISDWVILNCSFSRPDLPASVHWFRGRVPVPESPHYHLAGSFLFLPQISPSDSGPWGCTLTYRDGFNVSIMYNLTVLGLEPSGPLTVYTGAGSRVGLPCRLPPGVGTQSFLTAKWTPPGGGPDLLVAGDDGNFTLQLEVVNQAQAGTYTCHIHLQGQQLSTTVTLAVITVTPKSSGLPGNLRKLLCEVTPASGQERFVWSPLDKQSWRGSPGPCLEMQETRLLSQPWQCHVYQAERLLGTAVYLIDPAGPGAQRSGRAQGVLKTGHLS

Molecular Weight

Approximately 47 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years from date of receipt. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

LAG-3 Protein, Canine (HEK293, Flag, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAG-3 Protein, Canine (HEK293, Flag, His)
Cat. No.:
HY-P790057
Quantity:
MCE Japan Authorized Agent: