1. Recombinant Proteins
  2. Others
  3. LALBA Protein, Human (HEK293, His)

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LALBA Protein, Human (HEK293, His) is 123 a.a., with molecular weight of 14 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LALBA proteins are regulatory subunits of lactose synthase and play a key role in altering the substrate specificity of mammary galactosyltransferase. This modification allows galactosyltransferase to utilize glucose, promoting the synthesis of lactose - the main milk carbohydrate. LALBA Protein, Human (HEK293, His) is the recombinant human-derived LALBA protein, expressed by HEK293 , with C-6*His labeled tag. The total length of LALBA Protein, Human (HEK293, His) is 123 a.a., with molecular weight of 14 kDa.

Background

LALBA protein serves as the regulatory subunit of lactose synthase, exerting a pivotal role in altering the substrate specificity of galactosyltransferase within the mammary gland. This modification enables galactosyltransferase to utilize glucose as a proficient acceptor substrate, facilitating the synthesis of lactose—the predominant carbohydrate constituent of milk. Beyond its involvement in lactose synthesis, in various tissues, galactosyltransferase transfers galactose onto the N-acetylglucosamine of oligosaccharide chains in glycoproteins. Functioning as part of lactose synthase (LS), LALBA collaborates with the catalytic component, beta1,4-galactosyltransferase (beta4Gal-T1), to form a heterodimeric complex that orchestrates the intricate processes of lactose production, contributing to the essential composition of milk.

Species

Human

Source

HEK293

Tag

C-6*His

Accession

P00709 (K20-L142)

Gene ID
Molecular Construction
N-term
LALBA (K20-L142)
Accession # P00709
6*His
C-term
Synonyms
rHuAlpha-lactalbumin/LALBA, His; Lactose synthase B protein; Lysozyme-like protein 7; LALBA; LYZL7
AA Sequence

KQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL

Molecular Weight

14 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Solution.

Formulation

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCl, 150 mM NaCl, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Storage & Stability

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping

Shipping with dry ice.

Documentation

LALBA Protein, Human (HEK293, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LALBA Protein, Human (HEK293, His)
Cat. No.:
HY-P70229
Quantity:
MCE Japan Authorized Agent: