1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Endothelial cell CD Proteins
  4. LAMP-1/CD107a
  5. LAMP1/CD107a Protein, Mouse (HEK293, His)

LAMP1/CD107a is a key lysosomal glycoprotein that regulates lysosomal biogenesis, pH, autophagy, and cholesterol homeostasis.It directly inhibits the TMEM175 proton channel, optimizing lysosomal acidity for efficient hydrolase activity.LAMP1/CD107a Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP1/CD107a protein, expressed by HEK293 , with C-6*His labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LAMP1/CD107a is a key lysosomal glycoprotein that regulates lysosomal biogenesis, pH, autophagy, and cholesterol homeostasis.It directly inhibits the TMEM175 proton channel, optimizing lysosomal acidity for efficient hydrolase activity.LAMP1/CD107a Protein, Mouse (HEK293, His) is the recombinant mouse-derived LAMP1/CD107a protein, expressed by HEK293 , with C-6*His labeled tag.

Background

LAMP1/CD107a, a lysosomal membrane glycoprotein, assumes a crucial role in lysosome biogenesis, lysosomal pH regulation, autophagy, and cholesterol homeostasis. It serves as a direct inhibitor of the proton channel TMEM175, playing a pivotal role in lysosomal lumen pH regulation and facilitating optimal lysosomal acidification for efficient hydrolase activity. Additionally, LAMP1 is integral to NK-cell cytotoxicity, participating in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. Remarkably, it safeguards NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. LAMP1's involvement in presenting carbohydrate ligands to selectins, its role in tumor cell metastasis, and its interactions with proteins such as ABCB9 and FURIN underscore its multifaceted contributions to cellular processes. Notably, the interaction with TMEM175 highlights its inhibitory role in the proton channel activity of TMEM175, further emphasizing its regulatory function in lysosomal processes.

Species

Mouse

Source

HEK293

Tag

C-6*His

Accession

P11438 (L25-N370)

Gene ID
Molecular Construction
N-term
LAMP1 (L25-N370)
Accession # P11438
6*His
C-term
Synonyms
Lysosome-associated membrane glycoprotein 1; LAMP-1; LGP-A; CD107a; LAMPA; P2B
AA Sequence

LFEVKNNGTTCIMASFSASFLTTYETANGSQIVNISLPASAEVLKNGSSCGKENVSDPSLTITFGRGYLLTLNFTKNTTRYSVQHMYFTYNLSDTEHFPNAISKEIYTMDSTTDIKADINKAYRCVSDIRVYMKNVTVVLRDATIQAYLSSGNFSKEETHCTQDGPSPTTGPPSPSPPLVPTNPTVSKYNVTGNNGTCLLASMALQLNITYLKKDNKTVTRAFNISPNDTSSGSCGINLVTLKVENKNRALELQFGMNASSSLFFLQGVRLNMTLPDALVPTFSISNHSLKALQATVGNSYKCNTEEHIFVSKMLSLNVFSVQVQAFKVDSDRFGSVEECVQDGNN

Molecular Weight

55-94 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Requested Quantity *

Applicant Name *

 

Salutation

Email Address *

 

Phone Number *

Department

 

Organization Name *

City

State

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAMP1/CD107a Protein, Mouse (HEK293, His)
Cat. No.:
HY-P72526
Quantity:
MCE Japan Authorized Agent: