1. Recombinant Proteins
  2. CD Antigens
  3. NK Cell CD Proteins Stem Cell CD Proteins Platelet CD Proteins Erythrocyte CD Proteins Endothelial cell CD Proteins
  4. LAMP-1/CD107a
  5. LAMP1/CD107a Protein, Rat (HEK293, Fc)

The LAMP1/CD107a protein is a lysosomal membrane glycoprotein that plays critical roles in lysosomal biogenesis, pH regulation, autophagy, and cholesterol homeostasis.It critically regulates lysosomal lumen pH by inhibiting the proton channel TMEM175, optimizing lysosomal acidification for efficient hydrolase activity.LAMP1/CD107a Protein, Rat (HEK293, Fc) is the recombinant rat-derived LAMP1/CD107a protein, expressed by HEK293 , with C-hFc labeled tag.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

The LAMP1/CD107a protein is a lysosomal membrane glycoprotein that plays critical roles in lysosomal biogenesis, pH regulation, autophagy, and cholesterol homeostasis.It critically regulates lysosomal lumen pH by inhibiting the proton channel TMEM175, optimizing lysosomal acidification for efficient hydrolase activity.LAMP1/CD107a Protein, Rat (HEK293, Fc) is the recombinant rat-derived LAMP1/CD107a protein, expressed by HEK293 , with C-hFc labeled tag.

Background

LAMP1/CD107a protein, a lysosomal membrane glycoprotein, assumes a pivotal role in lysosome biogenesis, lysosomal pH regulation, autophagy, and cholesterol homeostasis. It acts as a crucial regulator of lysosomal lumen pH by directly inhibiting the proton channel TMEM175, promoting optimal lysosomal acidification for efficient hydrolase activity. Beyond its involvement in cellular homeostasis, LAMP1 contributes significantly to NK-cell cytotoxicity. Mechanistically, it participates in the movement of cytotoxic granules to the cell surface and the trafficking of perforin to the lytic granule, safeguarding NK-cells from degranulation-associated damage caused by their own cytotoxic granule content. Moreover, LAMP1 plays a role in presenting carbohydrate ligands to selectins. Interactions with proteins like ABCB9 and FURIN are essential, stabilizing ABCB9 and protecting it from lysosomal degradation, while also inhibiting the proton channel activity of TMEM175.

Biological Activity
  • Measured by its binding ability in a functional ELISA. When Recombinant Rat LAMP1/CD107a is coated at 1 μg/mL(100 µL/well), Recombinant Human Galectin 3 binds with an apparent KD is 3.451 nM.
Species

Rat

Source

HEK293

Tag

C-hFc

Accession

P14562 (A22-N371)

Gene ID
Molecular Construction
N-term
LAMP1 (A22-N371)
Accession # P14562
hFc
C-term
Synonyms
Lysosome-Associated Membrane Glycoprotein 1; LAMP-1; CD107a
AA Sequence

APALFEVKDNNGTACIMASFSASFLTTYDAGHVSKVSNMTLPASAEVLKNSSSCGEKNASEPTLAITFGEGYLLKLTFTKNTTRYSVQHMYFTYNLSDTQFFPNASSKGPDTVDSTTDIKADINKTYRCVSDIRVYMKNVTIVLWDATIQAYLPSSNFSKEETRCPQDQPSPTTGPPSPSPPLVPTNPSVSKYNVTGDNGTCLLASMALQLNITYMKKDNTTVTRAFNINPSDKYSGTCGAQLVTLKVGNKSRVLELQFGMNATSSLFFLQGVQLNMTLPDAIEPTFSTSNYSLKALQASVGNSYKCNSEEHIFVSKALALNVFSVQVQAFRVESDRFGSVEECVQDGNN

Molecular Weight

Approximately 125 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation
Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAMP1/CD107a Protein, Rat (HEK293, Fc)
Cat. No.:
HY-P74782
Quantity:
MCE Japan Authorized Agent: