LAMTOR2 Protein, Human (His)

LAMTOR2 is a key component of the Ragulator complex, which centralizes amino acid sensing and mTORC1 activation in response to stimuli such as growth factors, energy levels, and amino acids. As an amino acid-activated guanine nucleotide exchange factor (GEF), the Ragulator complex recruits Rag GTPases (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) to the lysosomal membrane. LAMTOR2 Protein, Human (His) is the recombinant human-derived LAMTOR2 protein, expressed by E. coli , with N-His labeled tag.

As a crucial component of the Ragulator complex, LAMTOR2 plays a central role in amino acid sensing and the activation of mTORC1, a signaling complex that promotes cell growth in response to various stimuli, including growth factors, energy levels, and amino acids. Activated by amino acids, the Ragulator complex functions as a guanine nucleotide exchange factor (GEF) for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD), simultaneously mediating the recruitment of Rag GTPases to the lysosome membrane. This orchestrated activation of the Ragulator and Rag GTPases serves as a scaffold, recruiting mTORC1 to lysosomes, where it is subsequently activated. Additionally, LAMTOR2 acts as an adapter protein enhancing the efficiency of the MAP kinase cascade, facilitating the activation of MAPK2 (By similarity). LAMTOR2 is part of the Ragulator complex, interacting with LAMTOR1 and LAMTOR3, and is a key player in the lysosomal folliculin complex (LFC), which includes FLCN, FNIP1 (or FNIP2), RagA/RRAGA or RagB/RRAGB GDP-bound, RagC/RRAGC or RagD/RRAGD GTP-bound, and Ragulator.

Human

E. coli

N-6*His

Q9Y2Q5-1 (M1-S125)

28956  [NCBI]

MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

Approximately 13 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution

Supplied as a 0.2 μm filtered solution of 20 mM Tris-HCL, 150 mM NaCl, pH 8.0, 10% Glycerol.

<1 EU/μg, determined by LAL method.

N/A.

Stored at -80°C for 1 year from date of receipt. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.