1. Recombinant Proteins
  2. Others
  3. LAMTOR2 Protein, Human (His)

LAMTOR2 Protein, Human (His)

Cat. No.: HY-P77053
Handling Instructions

LAMTOR2 is a key component of the Ragulator complex, which centralizes amino acid sensing and mTORC1 activation in response to stimuli such as growth factors, energy levels, and amino acids. As an amino acid-activated guanine nucleotide exchange factor (GEF), the Ragulator complex recruits Rag GTPases (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) to the lysosomal membrane. LAMTOR2 Protein, Human (His) is the recombinant human-derived LAMTOR2 protein, expressed by E. coli , with N-His labeled tag.

For research use only. We do not sell to patients.

Protein Expression Service

Size Stock
50 μg   Get quote  
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

LAMTOR2 is a key component of the Ragulator complex, which centralizes amino acid sensing and mTORC1 activation in response to stimuli such as growth factors, energy levels, and amino acids. As an amino acid-activated guanine nucleotide exchange factor (GEF), the Ragulator complex recruits Rag GTPases (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD) to the lysosomal membrane. LAMTOR2 Protein, Human (His) is the recombinant human-derived LAMTOR2 protein, expressed by E. coli , with N-His labeled tag.

Background

As a crucial component of the Ragulator complex, LAMTOR2 plays a central role in amino acid sensing and the activation of mTORC1, a signaling complex that promotes cell growth in response to various stimuli, including growth factors, energy levels, and amino acids. Activated by amino acids, the Ragulator complex functions as a guanine nucleotide exchange factor (GEF) for the small GTPases Rag (RagA/RRAGA, RagB/RRAGB, RagC/RRAGC, and/or RagD/RRAGD), simultaneously mediating the recruitment of Rag GTPases to the lysosome membrane. This orchestrated activation of the Ragulator and Rag GTPases serves as a scaffold, recruiting mTORC1 to lysosomes, where it is subsequently activated. Additionally, LAMTOR2 acts as an adapter protein enhancing the efficiency of the MAP kinase cascade, facilitating the activation of MAPK2 (By similarity). LAMTOR2 is part of the Ragulator complex, interacting with LAMTOR1 and LAMTOR3, and is a key player in the lysosomal folliculin complex (LFC), which includes FLCN, FNIP1 (or FNIP2), RagA/RRAGA or RagB/RRAGB GDP-bound, RagC/RRAGC or RagD/RRAGD GTP-bound, and Ragulator.

Species

Human

Source

E. coli

Tag

N-6*His

Accession

Q9Y2Q5-1 (M1-S125)

Gene ID
Molecular Construction
N-term
His
LAMTOR2 (M1-S125)
Accession # Q9Y2Q5-1
C-term
Synonyms
Ragulator complex protein LAMTOR2; MAPBP-interacting protein; MAPBPIP; ROBLD3; HSPC003
AA Sequence

MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

Molecular Weight

Approximately 13 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE

Endotoxin Level

<1 EU/μg, determined by LAL method.

Documentation

LAMTOR2 Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
LAMTOR2 Protein, Human (His)
Cat. No.:
HY-P77053
Quantity:
MCE Japan Authorized Agent: