1. Recombinant Proteins
  2. Enzymes & Regulators
  3. Protease Inhibitors
  4. Latexin Protein, Human (His)

Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (His) is the recombinant human-derived Latexin protein, expressed by E. coli , with N-His labeled tag. The total length of Latexin Protein, Human (His) is 221 a.a., with molecular weight of 30-35 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
5 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg In-stock
> 100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (His) is the recombinant human-derived Latexin protein, expressed by E. coli , with N-His labeled tag. The total length of Latexin Protein, Human (His) is 221 a.a., with molecular weight of 30-35 kDa.

Background

Latexin, a protein of significance, functions as a robust, hardly reversible, and non-competitive inhibitor targeting CPA1, CPA2, and CPA4. Its inhibitory prowess underscores its potential role in modulating the activity of carboxypeptidases, contributing to intricate cellular processes. Notably, Latexin may also partake in the regulation of inflammation, suggesting its involvement in broader physiological contexts beyond enzyme inhibition.

Species

Human

Source

E. coli

Tag

N-His

Accession

Q9BS40/NP_064554.3 (E2-E222)

Gene ID
Molecular Construction
N-term
His
Latexin (E2-E222)
Accession # Q9BS40/NP_064554.3
C-term
Synonyms
ECI; ECIMUM; Latexin; LXN; TCI
AA Sequence

EIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

Molecular Weight

30-35 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE.
Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or sterile 50 mM HEPES, 300 mM NaCL, pH 7.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Latexin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Latexin Protein, Human (His)
Cat. No.:
HY-P73841
Quantity:
MCE Japan Authorized Agent: