Latexin Protein, Human (His)

Latexin, a protein, powerfully inhibits CPA1, CPA2, and CPA4, playing a crucial role in controlling carboxypeptidase activity. It may also regulate inflammation, expanding its physiological significance beyond enzyme inhibition. Latexin Protein, Human (His) is the recombinant human-derived Latexin protein, expressed by E. coli , with N-His labeled tag. The total length of Latexin Protein, Human (His) is 221 a.a., with molecular weight of 30-35 kDa.

Latexin, a protein of significance, functions as a robust, hardly reversible, and non-competitive inhibitor targeting CPA1, CPA2, and CPA4. Its inhibitory prowess underscores its potential role in modulating the activity of carboxypeptidases, contributing to intricate cellular processes. Notably, Latexin may also partake in the regulation of inflammation, suggesting its involvement in broader physiological contexts beyond enzyme inhibition.

Human

E. coli

N-His

Q9BS40/NP_064554.3 (E2-E222)

56925  [NCBI]

EIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTFYQRLKSMKEPLEAQNIPDNFGNVSPEMTLVLHLAWVACGYIIWQNSTEDTWYKMVKIQTVKQVQRNDDFIELDYTILLHNIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEVQLE

30-35 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or sterile 50 mM HEPES, 300 mM NaCL, pH 7.5.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.