Layilin/LAYN Protein, Rat (HEK293)

Layilin (LAYN), predicted to bind hyaluronic acid, is expected to function as a membrane integral component. Its biased expression in tissues like the spleen (RPKM 32.4) and lung (RPKM 17.5) underscores Layilin's potential roles in diverse cellular processes across various physiological contexts. Layilin/LAYN Protein, Rat (HEK293) is the recombinant rat-derived Layilin/LAYN protein, expressed by HEK293 , with tag free.

Layilin (LAYN) is predicted to possess hyaluronic acid binding activity and is anticipated to serve as an integral component of the cellular membrane. This protein, orthologous to human LAYN (layilin), exhibits biased expression in various tissues, including the spleen (RPKM 32.4) and lung (RPKM 17.5), highlighting its potential involvement in diverse cellular processes and physiological contexts.

Measured by its binding ability in a functional ELISA. Immobilized Layilin at 5 µg/mL (100 µL/well) can bind biotinylated hyaluronan. The ED₅₀ for this effect is 7.316 µg/mL.

Rat

HEK293

Tag Free

NP_001178926.1 (H25-E224)

500996  [NCBI]

HLLSGDLDPRGGQRFCWEGTRRPCYRVIYFHDTSQRRNFEEAKEACMKDGGQLASIETADEQRLIENFIESLQASDGDFWIGLKRLEEKQHNSTACQDLYAWTDGSLSQFRNWYMDEPSCESEVCVVMYHQPSAPPGIGGPYMFQWNDDRCNTKKNFICKYSDDKPSTTPSLSPGGEATEPAAPILPEETLEIDTKERRE

Approximately 30-35 kDa due to the glycosylation.

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween 80 are added as protectants before lyophilization.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.