1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Leptin
  5. Leptin Protein, Carassius auratus (P.pastoris, His)

Leptin Protein, Carassius auratus (P.pastoris, His)

Cat. No.: HY-P70181
SDS COA Handling Instructions Technical Support

Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag. The total length of Leptin Protein, Carassius auratus (P.pastoris, His) is 150 a.a., with molecular weight of ~17.0 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Leptin protein plays a pivotal role in regulating energy balance and body weight. It binds to its receptor, LEPR, in various tissues, activating signaling pathways that regulate energy homeostasis. Leptin Protein, Carassius auratus (P.pastoris, His) is the recombinant Leptin protein, expressed by P. pastoris , with N-8*His labeled tag. The total length of Leptin Protein, Carassius auratus (P.pastoris, His) is 150 a.a., with molecular weight of ~17.0 kDa.

Background

Leptin protein assumes a pivotal role in the intricate regulation of energy balance and the control of body weight. Upon release into the circulation, leptin exerts both central and peripheral effects by binding to its receptor, LEPR, present in various tissues. This binding initiates the activation of several major signaling pathways, contributing to the multifaceted mechanisms involved in the regulation of energy homeostasis.

Species

Others

Source

P. pastoris

Tag

N-8*His

Accession

B8YI02 (P22-C171)

Gene ID

/

Molecular Construction
N-term
8*His
Leptin (P22-C171)
Accession # B8YI02
C-term
Synonyms
rCaLeptin, His; Leptin; Obese Protein; Obesity Factor; LEP; OB; OBS
AA Sequence

PVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC

Molecular Weight

Approximately 17.0 kDa

Purity

Greater than 95% as determined by reducing SDS-PAGE.

Appearance

Lyophilized powder.

Formulation

Lyophilized from a 0.2 μm filtered solution of 20 mM Citrate, 8% Trehalose, 4% Mannitol, 0.02% Tween80 (w/v), pH 5.5.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O.

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Leptin Protein, Carassius auratus (P.pastoris, His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Leptin Protein, Carassius auratus (P.pastoris, His)
Cat. No.:
HY-P70181
Quantity:
MCE Japan Authorized Agent: