1. Recombinant Proteins
  2. Cytokines and Growth Factors
  3. Peptide Hormone & Neuropeptides
  4. Leptin
  5. Leptin Protein, Human (His)

Leptin Protein, Human (His)

Cat. No.: HY-P7232A
SDS COA Handling Instructions

Leptin is an important energy regulator that regulates appetite, metabolism, and immune responses through its central receptor LEPR. In the hypothalamus, it reduces food intake, affects neuropeptides, and affects bone mass and reproductive function. Leptin Protein, Human (His) is the recombinant human-derived Leptin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Leptin Protein, Human (His) is 146 a.a., with molecular weight of ~17 kDa.

For research use only. We do not sell to patients.

Surface Plasmon Resonance (SPR) Assay Service   Protein Expression Service

Size Price Stock Quantity
Free Sample   Apply now
2 μg In-stock
10 μg In-stock
50 μg In-stock
100 μg   Get quote  

* Please select Quantity before adding items.

Top Publications Citing Use of Products
  • Biological Activity

  • Technical Parameters

  • Properties

  • Documentation

Description

Leptin is an important energy regulator that regulates appetite, metabolism, and immune responses through its central receptor LEPR. In the hypothalamus, it reduces food intake, affects neuropeptides, and affects bone mass and reproductive function. Leptin Protein, Human (His) is the recombinant human-derived Leptin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Leptin Protein, Human (His) is 146 a.a., with molecular weight of ~17 kDa.

Background

Leptin, a pivotal regulator of energy balance and body weight, exerts central and peripheral effects upon binding to its receptor, LEPR, distributed across various tissues. In the hypothalamus, Leptin acts as an appetite-regulating factor, decreasing food intake and increasing energy consumption by modulating anorexinogenic and orexigenic neuropeptides. Additionally, it influences bone mass, hypothalamo-pituitary-adrenal hormone secretion, and reproductive function. In peripheral tissues, Leptin enhances basal metabolism, regulates pancreatic beta-cell function and insulin secretion, and exhibits pro-angiogenic effects on endothelial cells, impacting both innate and adaptive immunity. Within the hypothalamic arcuate nucleus, Leptin activates POMC neurons, releasing anorexigenic peptides upon depolarization, and inhibits NPY neurons upon hyperpolarization, reducing the release of orexigenic peptides. Beyond its role in satiety, Leptin modulates nutrient absorption in the intestine by inhibiting glucose absorption through PKC activation and subsequent signaling pathways. Leptin also acts as a growth factor, influencing cell cycle regulation and gene expression. Moreover, it plays a role in apoptosis, angiogenesis, and immune responses, exhibiting pro-inflammatory effects and promoting T helper-1 cell immune responses in adaptive immunity. Leptin's multifaceted functions highlight its intricate involvement in maintaining energy homeostasis and coordinating various physiological processes.

Biological Activity

Fully biologically active determined by the dose dependent proliferation of MCF7 cells. The ED50 for this effect is 14.64 ng/mL, corresponding to a specific activity is 6.83×104 units/mg.

  • Fully biologically active determined by the dose dependent proliferation of MCF7 cells. The ED50 for this effect is 14.64 ng/mL, corresponding to a specific activity is 6.83×104 units/mg.
Species

Human

Source

E. coli

Tag

N-6*His

Accession

P41159 (V22-C167)

Gene ID
Molecular Construction
N-term
6*His
Leptin (V22-C167)
Accession # P41159
C-term
Synonyms
rHuLeptin; Obesity protein; OB
AA Sequence

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Molecular Weight

Approximately 17 kDa

Purity
  • Greater than 95% as determined by reducing SDS-PAGE
Appearance

Lyophilized powder.

Formulation

Lyophilized from after extensive dialysis against 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

Endotoxin Level

<1 EU/μg, determined by LAL method.

Reconstitution

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH2O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Storage & Stability

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Shipping

Room temperature in continental US; may vary elsewhere.

Documentation

Leptin Protein, Human (His) Related Classifications

Help & FAQs
  • Do most proteins show cross-species activity?

    Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

  • Reconstitution Calculator

  • Dilution Calculator

  • Specific Activity Calculator

The reconstitution calculator equation

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration

Volume (to add to vial) = Mass (in vial) ÷ Desired Reconstitution Concentration
= ÷

The dilution calculator equation

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)

This equation is commonly abbreviated as: C1V1 = C2V2

Concentration (start) × Volume (start) = Concentration (final) × Volume (final)
× = ×
C1   V1   C2   V2

The specific activity calculator equation

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)

Specific Activity (Unit/mg) = 106 ÷ Biological Activity (ED50)
Unit/mg = 106 ÷ ng/mL

Your Recently Viewed Products:

Inquiry Online

Your information is safe with us. * Required Fields.

Product Name

 

Salutation

Applicant Name *

 

Email Address *

Phone Number *

 

Organization Name *

Department *

 

Requested quantity *

Country or Region *

     

Remarks

Bulk Inquiry

Inquiry Information

Product Name:
Leptin Protein, Human (His)
Cat. No.:
HY-P7232A
Quantity:
MCE Japan Authorized Agent: