Leptin Protein, Human (His)

Leptin is an important energy regulator that regulates appetite, metabolism, and immune responses through its central receptor LEPR. In the hypothalamus, it reduces food intake, affects neuropeptides, and affects bone mass and reproductive function. Leptin Protein, Human (His) is the recombinant human-derived Leptin protein, expressed by E. coli , with N-6*His labeled tag. The total length of Leptin Protein, Human (His) is 146 a.a., with molecular weight of ~17 kDa.

Leptin, a pivotal regulator of energy balance and body weight, exerts central and peripheral effects upon binding to its receptor, LEPR, distributed across various tissues. In the hypothalamus, Leptin acts as an appetite-regulating factor, decreasing food intake and increasing energy consumption by modulating anorexinogenic and orexigenic neuropeptides. Additionally, it influences bone mass, hypothalamo-pituitary-adrenal hormone secretion, and reproductive function. In peripheral tissues, Leptin enhances basal metabolism, regulates pancreatic beta-cell function and insulin secretion, and exhibits pro-angiogenic effects on endothelial cells, impacting both innate and adaptive immunity. Within the hypothalamic arcuate nucleus, Leptin activates POMC neurons, releasing anorexigenic peptides upon depolarization, and inhibits NPY neurons upon hyperpolarization, reducing the release of orexigenic peptides. Beyond its role in satiety, Leptin modulates nutrient absorption in the intestine by inhibiting glucose absorption through PKC activation and subsequent signaling pathways. Leptin also acts as a growth factor, influencing cell cycle regulation and gene expression. Moreover, it plays a role in apoptosis, angiogenesis, and immune responses, exhibiting pro-inflammatory effects and promoting T helper-1 cell immune responses in adaptive immunity. Leptin's multifaceted functions highlight its intricate involvement in maintaining energy homeostasis and coordinating various physiological processes.

Fully biologically active determined by the dose dependent proliferation of MCF7 cells. The ED₅₀ for this effect is 14.64 ng/mL, corresponding to a specific activity is 6.83×10⁴ units/mg.

• 
  Fully biologically active determined by the dose dependent proliferation of MCF7 cells. The ED₅₀ for this effect is 14.64 ng/mL, corresponding to a specific activity is 6.83×10⁴ units/mg.

Human

E. coli

N-6*His

P41159 (V22-C167)

3952  [NCBI]

VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Approximately 17 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from after extensive dialysis against 50 mM Tris-HCL, 300 mM NaCl, 200 mM arginine, pH 8.0.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.