LIF Protein, Human

LIF Protein, Human is a lymphoid factor involved in various neural and inflammatory processes such as the acute-phase reaction, tissue damage, and infection.

Leukemia Inhibitory Factor has been shown to possess a remarkable variety of actions. It releases calcium from bone tissue, and is the differentiation inhibitory factor preventing spontaneous differentiation in normal embryonic stem cells^[1]. Leukemia inhibitory factor (LIF) is a neuropoietic cytokine involved in both the neural and immune responses to injury. Its levels are increased in a variety of animal and human inflammatory conditions. Administration of Leukemia Inhibitory Factor can suppress inflammatory signs in some cases, for instance after intratracheal lipopolysaccharide-induced inflammation. Leukemia Inhibitory Factor also increases corticosterone levels via the hypothalamo-pituitary-adrenal axis. Other evidence suggests, that it can also act as a proinflammatory cytokine. Exogenously added Leukemia Inhibitory Factor induces acute phase protein expression and stimulates the production of proinflammatory cytokines and monocyte chemoattractants^[2].

1.The ED₅₀ is <0.2 ng/mL as measured by TF-1 cells, corresponding to a specific activity of >4.9 × 10⁶ units/mg.
2.Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED₅₀ for this effect is 25-204.1 pg/mL.

• 
  Measured in a cell proliferation assay using TF-1 human erythroleukemic cells. The ED ED₅₀ for this effect is 0.1155 ng/mL, corresponding to a specific activity is 8.658×10⁶units/mg.

Human

E. coli

Tag Free

P15018-1 (S23-F202)

3976  [NCBI]

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Approximately 18-20 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized after extensive dialysis against PBS.

<0.2 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.

• [1]. Metcalf D, et al. Effects of injected leukemia inhibitory factor on hematopoietic and other tissues in mice. Blood. 1990 Jul 1;76(1):50-6.  [Content Brief]

  [2]. Banner LR, et al. Leukemia inhibitory factor is an anti-inflammatory and analgesic cytokine. J Neurosci. 1998 Jul 15;18(14):5456-62.  [Content Brief]

  [3]. Gearing DP, et al. Leukemia inhibitory factor receptor is structurally related to the IL-6 signal transducer, gp130. EMBO J. 1991 Oct;10(10):2839-48.  [Content Brief]