LIF Protein, Mouse (HEK293)

LIF (Leukemia Inhibitory Factor) prompts terminal differentiation in leukemic cells, inducing hematopoietic and neuronal cell differentiation. It also stimulates acute-phase protein synthesis in hepatocytes. LIF's multifaceted role underscores its significance in regulating hematopoiesis, neurogenesis, and hepatic responses. LIF Protein, Mouse (HEK293) is the recombinant mouse-derived LIF protein, expressed by HEK293 , with tag free.

LIF (Leukemia Inhibitory Factor) exhibits the capability to prompt terminal differentiation in leukemic cells, showcasing a diverse range of activities. Notably, it induces hematopoietic differentiation in both normal and myeloid leukemia cells, facilitates neuronal cell differentiation, and stimulates the synthesis of acute-phase proteins in hepatocytes. This multifaceted role underscores LIF's significance in orchestrating various cellular processes, contributing to the regulation of hematopoiesis, neurogenesis, and hepatic responses.

1. Measured by its ability to inhibit the proliferation of M1 mouse myeloid leukemia cells.The ED₅₀ for this effect is typically 0.1-0.5 ng/mL.
2. Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ this effect is 69.78 ng/mL, corresponding to a specific activity is 1.4331×10⁴ units/mg.

• 
  Measured in a cell proliferation assay using M-NFS-60 cells. The ED₅₀ this effect is 69.78 ng/mL, corresponding to a specific activity is 1.4331×10⁴ units/mg.

Mouse

HEK293

Tag Free

P09056/NP_032527.1 (S24-F203)

16878  [NCBI]

SPLPITPVNATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF

Approximately 35.6 kDa

Greater than 95% as determined by reducing SDS-PAGE

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 or 20 mM PB, 150 mM NaCl, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.