LILRA5/CD85f Protein, Rat (HEK293, His)

The LILRA5/CD85f protein is predicted to have inhibitory MHC class I receptor activity and may modulate immune responses. Involved in the MAPK cascade and regulation of cytokine production, expected to be active on the cell surface and extracellular space, and in the plasma membrane. LILRA5/CD85f Protein, Rat (HEK293, His) is the recombinant rat-derived LILRA5/CD85f protein, expressed by HEK293 , with C-His labeled tag. The total length of LILRA5/CD85f Protein, Rat (HEK293, His) is 232 a.a., with molecular weight of ~37 kDa.

LILRA5/CD85f Protein is predicted to possess inhibitory MHC class I receptor activity, indicating its potential role in immune modulation. Predicted to participate in processes such as positive regulation of the MAPK cascade, positive regulation of protein tyrosine kinase activity, and the regulation of cytokine production, this protein is expected to be located on the cell surface and in the extracellular space, with predicted activity in the plasma membrane. LILRA5 is orthologous to several human genes, including LILRA5 (leukocyte immunoglobulin-like receptor A5), suggesting evolutionary conservation of its functions. The protein demonstrates biased expression, with significant levels observed in the Spleen (RPKM 160.9), Liver (RPKM 62.0), and seven other tissues, underscoring its potential importance in immune-related processes across various tissues.

Measured by its binding ability in a functional ELISA. When Recombinant Human LILRA5/CD85f is coated at 2 µg/mL can bind ANGPTL7. The ED₅₀ for this effect is 0.5874 μg/mL.

• 
  Measured by its binding ability in a functional ELISA. When Recombinant Human LILRA5/CD85f is coated at 2 µg/mL can bind ANGPTL7. The ED₅₀ for this effect is 0.5874 μg/mL.

Rat

HEK293

C-His

NP_001070261.1 (Q17-N248)

691533  [NCBI]

QETSGLEGNPHKPTLSVQPGSLVARGKQVTILCEVTTGAQEYRLFKEGGPHPWRTKNTPKATNKAQFLISSIEQQHGGIYRCYYKTPSGWSEHSDPLELVVTGLYSKPSLSIQSSTVVTSGETVTLQCVSQLGFNRFVLTKEGEQKPSLIRDSEFINSTGQFQGLFPMGPVILSQRWMFRCYGYYVNSPQVWSEPSDLLEIHVSEAAQPLGLSPNISHPKTVSQHQDYTMEN

Approximately 33-40 kDa due to the glycosylation

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.