LILRA6/CD85b/ILT8 Protein, Human (HEK293, N-His)

LILRA6/CD85b/ILT-8 protein serves as a receptor for class I MHC antigens and plays a crucial role in immune recognition and regulation. Its interaction with class I MHC molecules has been shown to be involved in monitoring and potentially modulating immune responses. LILRA6/CD85b/ILT8 Protein, Human (HEK293, N-His) is the recombinant human-derived LILRA6/CD85b/ILT8 protein, expressed by HEK293 , with N-6*His labeled tag.

LILRA6/CD85b/ILT-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and regulation. Its ability to interact with class I MHC molecules indicates its involvement in monitoring and potentially modulating immune responses. As a receptor, LILRA6 may contribute to the precise recognition of cells presenting class I MHC antigens, thereby influencing immune activities. Further exploration of LILRA6's interactions and its impact on immune signaling could deepen our understanding of its role as a receptor and its potential implications in immune surveillance and regulatory mechanisms.

Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED₅₀ for this effect is 0.2214 μg/ml, corresponding to a specific activity is 4.52×103 units/mg.

• 
  Measured in a cell proliferation assay using Jurkat human T-lymphocyte leukemia cells. The ED₅₀ for this effect is 0.2214 μg/mL, corresponding to a specific activity is 4.52×10³ units/mg.

Human

HEK293

N-6*His

Q6PI73-1 (G24-N447)

79168  [NCBI]

GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN

55-85 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.