LILRB5/CD85c/LIR-8 Protein, Human (433a.a, HEK293, His)

The LILRB5/CD85c/LIR-8 protein functions as a receptor for class I MHC antigens, suggesting a critical role in immune recognition and regulation. Its interaction with MHC class I molecules suggests involvement in surveillance and may influence immune responses. LILRB5/CD85c/LIR-8 Protein, Human (433a.a, HEK293, His) is the recombinant human-derived LILRB5/CD85c/LIR-8 protein, expressed by HEK293 , with C-6*His labeled tag.

LILRB5/CD85c/LIR-8 Protein appears to function as a receptor for class I MHC antigens, suggesting a pivotal role in immune recognition and modulation. Its capacity to interact with class I MHC molecules underscores its involvement in monitoring and potentially influencing immune responses. As a receptor, LILRB5 may contribute to the regulation of immune activities, particularly in the context of recognizing and responding to cells displaying class I MHC antigens. Further exploration of LILRB5's interactions and its impact on immune signaling could enhance our understanding of its role as a receptor and its potential implications in immune surveillance and modulation.

Human

HEK293

C-6*His

O75023-1 (G24-H456)

10990  [NCBI]

GTLPKPTLWAEPASVIARGKPVTLWCQGPLETEEYRLDKEGLPWARKRQNPLEPGAKAKFHIPSTVYDSAGRYRCYYETPAGWSEPSDPLELVATGFYAEPTLLALPSPVVASGGNVTLQCDTLDGLLTFVLVEEEQKLPRTLYSQKLPKGPSQALFPVGPVTPSCRWRFRCYYYYRKNPQVWSNPSDLLEILVPGVSRKPSLLIPQGSVVARGGSLTLQCRSDVGYDIFVLYKEGEHDLVQGSGQQPQAGLSQANFTLGPVSRSHGGQYRCYGAHNLSPRWSAPSDPLDILIAGLIPDIPALSVQPGPKVASGENVTLLCQSWHQIDTFFLTKEGAAHPPLCLKSKYQSYRHQAEFSMSPVTSAQGGTYRCYSAIRSYPYLLSSPSYPQELVVSGPSGDPSLSPTGSTPTPGPEDQPLTPTGLDPQSGLGRH

Approximately 72 kDa

Greater than 95% as determined by reducing SDS-PAGE.

Lyophilized powder.

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

<1 EU/μg, determined by LAL method.

It is not recommended to reconstitute to a concentration less than 100 μg/mL in ddH₂O. For long term storage it is recommended to add a carrier protein (0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose).

Stored at -20°C for 2 years. After reconstitution, it is stable at 4°C for 1 week or -20°C for longer (with carrier protein). It is recommended to freeze aliquots at -20°C or -80°C for extended storage.

Room temperature in continental US; may vary elsewhere.