Lipocalin-2/NGAL Protein, Human (HEK293, His)

Lipocalin-2/NGAL is an iron transporter that plays a crucial role in various cellular processes. It interacts with the siderophore 2,3-DHBA to transport iron into or out of cells depending on cellular needs. Lipocalin-2/NGAL Protein, Human (HEK293, His) is the recombinant human-derived Lipocalin-2/NGAL protein, expressed by HEK293 , with C-6*His labeled tag.

Lipocalin-2/NGAL, an iron-trafficking protein, plays a pivotal role in diverse cellular processes, including apoptosis, innate immunity, and renal development. Through its interaction with the siderophore 2,3-dihydroxybenzoic acid (2,3-DHBA), bearing structural resemblance to bacterial enterobactin, Lipocalin-2/NGAL serves as a versatile mediator for the transport of iron into or out of cells, contingent on specific cellular requirements. The iron-bound form (holo-24p3) undergoes internalization upon binding to the SLC22A17 (24p3R) receptor, leading to the liberation of iron and a subsequent rise in intracellular iron concentration. Conversely, the association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor initiates a cascade involving an intracellular siderophore, resulting in iron chelation and subsequent extracellular iron transfer, ultimately reducing intracellular iron levels. In the context of apoptosis induced by interleukin-3 (IL3) deprivation, the iron-loaded form augments intracellular iron concentration without triggering apoptosis, while the iron-free form diminishes intracellular iron levels, inducing the expression of the proapoptotic protein BCL2L11/BIM, thereby promoting apoptosis. Lipocalin-2/NGAL's involvement in innate immunity manifests as it restricts bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin. Furthermore, Lipocalin-2/NGAL exhibits the ability to bind siderophores from M.tuberculosis. Its structural arrangements include a monomeric state and a homodimer linked by disulfide bonds, as well as a heterodimeric form in association with MMP9.

Fully biologically active determined by the dose dependent decrease in SH-SY5Y cell number. The ED₅₀ this effect is 0.1265 μg/mL, corresponding to a specific activity is 7.91×10³ units/mg.

• 
  Fully biologically active determined by the dose dependent decrease in SH-SY5Y cell number.  The ED₅₀ for this effect is 0.1265 μg/mL, corresponding to a specific activity is 7.91×10³ units/mg.

Human

HEK293

C-6*His

P80188-1 (Q21-G198)

3934  [NCBI]

QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

Approximately 21-24 kDa

• 
  Greater than 95% as determined by reducing SDS-PAGE.

Solution.

Supplied as a 0.2 μm filtered solution of PBS, 50% Glycerol, pH 7.4.

<1 EU/μg, determined by LAL method.

Stored at -80°C for 1 year. It is stable at -20°C for 3 months after opening. It is recommended to freeze aliquots at -80°C for extended storage. Avoid repeated freeze-thaw cycles.

Shipping with dry ice.